Protein

MCA_04327_1

Length
528 amino acids

Gene name: ATG18

Description: Autophagy-related protein 18

Browser: contigC:2717015-2718754-

RNA-seq: read pairs 1738, FPKM 40.6, percentile rank 60.6% (100% = highest expression)

Protein function

Annotation:ATG18Autophagy-related protein 18
KEGG:K17908WIPI autophagy-related protein 18
EGGNOG:0PH4RATG18The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Necessary for proper vacuole morphology. Plays an important role in osmotically-induced vacuole fragmentation. Required for cytoplasm to vacuole transport (Cvt) vesicle formation, pexophagy and starvation-induced autophagy. Involved in correct atg9 trafficking to the pre-autophagosomal structure. Might also be involved in premeiotic DNA replication (By similarity)
SGD closest match:S000001917ATG18Autophagy-related protein 18
CGD closest match:CAL0000198706ATG18Autophagy-related protein 18

Protein alignments

%idAln lengthE-value
MIA_00096_189.58%2884e-162MIA_00096_1
A0A0J9X9L1_GEOCN73.45%2756e-131Similar to Saccharomyces cerevisiae YFR021W ATG18 Phosphoinositide binding protein required for vesicle formation in autophagy and the cytoplasm-to-vacuole targeting (Cvt) pathway OS=Geotrichum candidum GN=BN980_GECA06s01011g PE=4 SV=1
A0A060T974_BLAAD70.26%2693e-125ARAD1D09416p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D09416g PE=4 SV=1
ATG18_YARLI69.60%2732e-121Autophagy-related protein 18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG18 PE=3 SV=1
UniRef50_Q6C04469.60%2734e-118Autophagy-related protein 18 n=31 Tax=Fungi TaxID=4751 RepID=ATG18_YARLI
A0A1E3PKV4_9ASCO65.96%2852e-118WD40 repeat-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_79335 PE=4 SV=1
A0A1E4TIF3_9ASCO63.14%2744e-114Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_21901 PE=4 SV=1
ATG18_CANAL48.97%2926e-87Autophagy-related protein 18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG18 PE=3 SV=2
ATG18_YEAST62.94%1431e-60Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG18 PE=1 SV=1
A0A167DD30_9ASCO62.94%1701e-49Phosphoinositide binding protein ATG18 OS=Sugiyamaella lignohabitans GN=ATG18 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2144

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Repeat
1 50 100 150 200 250 300 350 400 450 500 528

Detailed signature matches

  1. Domain IPR015943
    WD40/YVTN repeat-like-containing domain
    1. G3DSA:2.130.1...
  2. Domain IPR017986
    WD40-repeat-containing domain
    1. SSF50978 (WD40 repe...)
  3. Repeat IPR001680
    WD40 repeat
    1. PS50082 (WD_REPEATS_2)
    2. SM00320 (WD40_4)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_04327_1
MSYLQRSNSTRHYQDAINFVNFNQDFTCISVGTKNGYNLFNCDPFGKCFAKVDGGIGIVEMLFCTSLVAVVGVGDQPHLS
PRRLKIVNTKRKLNICELTFPTAVLKVKLNRKRLIVLLEEQIYIYDISNMQLLYTIETSPNPQAICSLSPSSENCYLAYP
SPAPQSSSPFAFPPHVPSSNQNTNTSPNRTGDVVVFDTISLQPVNVIEAHKSPLSCISFNNDGTLLATASDKGTIVRVFS
IPTATKLFQFRRGTYPSKIFSINFNLSSTLLAVSSATETVHVFRLARPGNINTNQNSSSSNGTRQGNNNNNTNNRSASIS
SDNDSNKSLNDNNNLEDNNNTNDNSGDILPQLSNDYSDPATTANSASLDALAESKRKPGSVASLLRRGSRTIGRSVAGAM
GNYLPTAVTEMWEPQRDFAFLKLPTSGSLMSSSSNNNNNNNRQNQQQDQSSSSSNNSSNITRTKTGGPITGGGGGGGIKS
VVAFNAASTRVFVVTAEGYFYQYAIDHAKGGECELLQQYSLLDNTEDY

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005515 protein binding

Cellular Component

None predicted.