Protein

MCA_04119_2

Length
62 amino acids

Gene name: RPL29

Description: 60S ribosomal protein L29

Browser: contigC:2109433-2109622-

RNA-seq: read pairs 23465, FPKM 4602.1, percentile rank 99.5% (100% = highest expression)

Protein function

Annotation:RPL2960S ribosomal protein L29
KEGG:K02905RP-L29e large subunit ribosomal protein L29e
EGGNOG:0PRZJRPL2960S ribosomal protein L29
SGD closest match:S000006437RPL2960S ribosomal protein L29
CGD closest match:CAL0000175799RPL2960S ribosomal protein L29

Protein alignments

%idAln lengthE-value
MIA_02676_172.55%512e-21MIA_02676_1
A0A0J9XH97_GEOCN74.51%512e-1860S ribosomal protein L29 OS=Geotrichum candidum GN=BN980_GECA14s02100g PE=3 SV=1
UniRef50_A0A0M8MQ2166.67%511e-1260S ribosomal protein L29 n=7 Tax=Opisthokonta TaxID=33154 RepID=A0A0M8MQ21_9BASI
Q6C2F1_YARLI64.71%511e-1560S ribosomal protein L29 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F08437g PE=3 SV=2
A0A1E3PRV0_9ASCO66.67%511e-1560S ribosomal protein L29 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_11277 PE=3 SV=1
A0A1E4TF02_9ASCO66.67%519e-1660S ribosomal protein L29 (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_11342 PE=3 SV=1
A0A060SYQ4_BLAAD64.71%512e-1560S ribosomal protein L29 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C02882g PE=3 SV=1
RL29_YEAST64.71%515e-1560S ribosomal protein L29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL29 PE=1 SV=3
A0A1D8PF57_CANAL62.75%518e-1560S ribosomal protein L29 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL29 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6509

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR002673
    Ribosomal protein L29e
    1. PD010314
    2. PF01779 (Ribosomal_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_04119_2
MSKSKNHTNHNQIKKAHRNGIKKPQKTPRSEQLKFLDPKFARNLKYAMRGSAKAVAAARAAK

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome