Protein
MIA_02676_1
Length
60 amino acids
Browser: contig03:1436066-1436249-
Protein function
EGGNOG: | 0PRZJ | RPL29 | 60S ribosomal protein L29 |
---|---|---|---|
SGD closest match: | S000006437 | RPL29 | 60S ribosomal protein L29 |
CGD closest match: | CAL0000175799 | RPL29 | 60S ribosomal protein L29 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XH97_GEOCN | 68.333% | 60 | 1.03e-21 | 60S ribosomal protein L29 OS=Geotrichum candidum GN=BN980_GECA14s02100g PE=3 SV=1 |
UniRef50_A0A0M8MQ21 | 65.000% | 60 | 3.69e-18 | 60S ribosomal protein L29 n=7 Tax=Opisthokonta TaxID=33154 RepID=A0A0M8MQ21_9BASI |
A0A1D8PF57_CANAL | 65.000% | 60 | 4.68e-19 | 60S ribosomal protein L29 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL29 PE=3 SV=1 |
Q6C2F1_YARLI | 63.333% | 60 | 6.15e-19 | 60S ribosomal protein L29 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F08437g PE=3 SV=2 |
A0A060SYQ4_BLAAD | 60.000% | 60 | 1.23e-18 | 60S ribosomal protein L29 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C02882g PE=3 SV=1 |
RL29_YEAST | 68.627% | 51 | 3.04e-17 | 60S ribosomal protein L29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL29 PE=1 SV=3 |
A0A1E4TF02_9ASCO | 60.000% | 55 | 3.34e-17 | 60S ribosomal protein L29 (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_11342 PE=3 SV=1 |
A0A1E3PRV0_9ASCO | 64.706% | 51 | 9.82e-17 | 60S ribosomal protein L29 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_11277 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9866
Protein family membership
- Ribosomal protein L29e (IPR002673)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_02676_1 MAKSKNHTNHNQIRKAHRNGIKKAKVASKQEALKHLDPKFVRNQKYALRGSQKAVAAAKA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome