Protein

MCA_04116_1

Length
498 amino acids


Gene name: HER2

Description: Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial

Browser: contigC:2098442-2100075+

RNA-seq: read pairs 1285, FPKM 31.8, percentile rank 54.4% (100% = highest expression)

Protein function

Annotation:HER2Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
KEGG:K02433gatA aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
EGGNOG:0PGBSHER2Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln) (By similarity)
SGD closest match:S000004907HER2Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial
CGD closest match:CAL0000174814HER2Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial

Protein alignments

%idAln lengthE-value
MIA_02673_169.76%4960.0MIA_02673_1
A0A0J9X8R2_GEOCN57.94%4850.0Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Geotrichum candidum GN=HER2 PE=3 SV=1
UniRef50_A0A0J9X8R257.94%4850.0Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X8R2_GEOCN
A0A060T486_BLAAD55.49%4838e-173Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Blastobotrys adeninivorans GN=HER2 PE=3 SV=1
A0A1E3PMN1_9ASCO49.49%4931e-149Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=HER2 PE=3 SV=1
A0A1E4TKC0_9ASCO48.25%4872e-137Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=HER2 PE=3 SV=1
GATA_YARLI46.23%4788e-130Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HER2 PE=3 SV=1
A0A167F5D0_9ASCO53.49%3876e-129Glutamyl-tRNA(Gln) amidotransferase subunit HER2 OS=Sugiyamaella lignohabitans GN=HER2 PE=4 SV=1
GATA_CANAL43.86%4565e-108Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HER2 PE=3 SV=2
GATA_YEAST43.54%4412e-105Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HER2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7096
Predicted cleavage: 25

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 450 498

Detailed signature matches

    1. MF_00120 (GatA)
    1. SSF75304 (Amidase s...)
    2. PF01425 (Amidase)
    1. PS00571 (AMIDASES)

Protein sequence

>MCA_04116_1
MNQISSALIRQQGERYISNILSKNKIYNAVVSMRKSDDILKDAEAATTANKGALSGKYYILKDNFCTTELPTACGSKALE
NYVSPYNSTTHELLLKAGGSYIGKANMDEFAMGSNNMTSGLYPYTVNPIFEDAATNPRTTGGSSGGSAAAVAAEMCDFAL
GSDTGGSVRLPAAYCGVVGFKPTYGAISRHGLVAYAQSLDTVGICAKDVATTETVYKVLNEFDERDPTSLDTSIRKKIED
YQNSIKKNGEKRKYKIGVIYENNLSDLDEHVRNAWVESLETLRSQGHEIVTVSVPSLKHALPTYFVVTPSEASSNLARYD
GIRYGHRAETDRLGDILYASTRSEGFCEEVQRRIILGVFNLSSDFFGNHFQQAQKVRRKIQMEFNNIFSFPNFASINQSA
ALSVGPKHETPVDVVISPASKTIAPTHEDIKKTTDAEGAVKSYVNDVLTVCPNIAGLPAISIPWGSGPKTIGMQVIGQFG
DDNTVLDVARILEKSQLE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0050567 glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity

Cellular Component

GO:0030956 glutamyl-tRNA(Gln) amidotransferase complex