MCA_04088_1
Gene name: ADA2
Description: Transcriptional adapter 2; protein with ZZ type Zinc finger, SANT/Myb and SWIRM domains
Browser: contigC:1981098-1982807+
RNA-seq: read pairs 1492, FPKM 33.5, percentile rank 55.7% (100% = highest expression)
Protein function
Annotation: | ADA2 | Transcriptional adapter 2; protein with ZZ type Zinc finger, SANT/Myb and SWIRM domains | |
---|---|---|---|
KEGG: | K11314 | TADA2A | transcriptional adapter 2-alpha |
EGGNOG: | 0PFFS | ADA2 | SAGA complex subunit Ada2 |
SGD closest match: | S000002856 | ADA2 | Transcriptional adapter 2 |
CGD closest match: | CAL0000192402 | ADA2 | Transcriptional adapter 2 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_04765_1 | 73.38% | 541 | 0.0 | MIA_04765_1 |
A0A0J9XJ81_GEOCN | 76.25% | 320 | 2e-175 | Transcriptional adapter 2 OS=Geotrichum candidum GN=BN980_GECA18s01770g PE=4 SV=1 |
A0A1E4TJV2_9ASCO | 64.39% | 337 | 2e-155 | Transcriptional adapter 2 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_80929 PE=4 SV=1 |
Q6C1P9_YARLI | 68.27% | 312 | 1e-154 | Transcriptional adapter 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F14443g PE=4 SV=1 |
UniRef50_Q6C1P9 | 68.27% | 312 | 3e-151 | Transcriptional adapter 2 n=4 Tax=Saccharomycetales TaxID=4892 RepID=Q6C1P9_YARLI |
A0A060T7U3_BLAAD | 65.38% | 312 | 2e-148 | Transcriptional adapter 2 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B22770g PE=4 SV=1 |
ADA2_CANAL | 60.65% | 310 | 1e-134 | Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADA2 PE=3 SV=2 |
A0A1E3PDK8_9ASCO | 59.64% | 337 | 1e-133 | Transcriptional adapter 2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43807 PE=4 SV=1 |
ADA2_YEAST | 58.01% | 312 | 2e-124 | Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADA2 PE=1 SV=1 |
A0A167E8F6_9ASCO | 68.05% | 266 | 4e-115 | Transcriptional adapter 2 OS=Sugiyamaella lignohabitans GN=ADA2 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0236
Protein family membership
- Transcriptional adaptor 2 (IPR016827)
Domains and repeats
-
Domain
Detailed signature matches
-
-
PIRSF025024 (Txn_ad...)
-
-
-
SSF46689 (Homeodoma...)
-
-
-
PS51293 (SANT)
-

-
-
SSF57850 (RING/U-box)
-
cd00167 (SANT)
-
cd02335 (ZZ_ADA2)
-
mobidb-lite (disord...)
Residue annotation
-
zinc cluster 1 cd0...
-
Zinc-binding sites...
-
putative charged b...
-
putative hydrophob...
-
zinc cluster 2 cd0...
-
DNA binding site c...
Protein sequence
>MCA_04088_1 MTVVNRTNAPANPLKAGEPGQKFHCDVCACDCSNLVRIRCAECTDYDLCVICFSKGKSSGNHKPWHKYMIVEQHAYPIFD EDWGADEELLLIEGMKTFGVGNWQDIADHIGGRSKEEVEEHYKRVYLESETYPVPNLKRKFNIDPSEFIEKRRRRIEDRR ANAMKLLPPKQKPTASVPSCHEVQGYMPGRLEFESEYENEAEMLVKDMIFEPEDNETEIELKLTVLDIYNSRLTSRAERK RVMIQHGLLDYRKNVALDKKRSKEEKDLLNTRLRVFARLMTPQDFNNFQTSVLAELYFRKRIAELQEYRRNGIRSFADAQ KYETDKAVRMATLNISGGGSGSSGLSSSPLSSHHVGSSRHTATSWAAASSRYAGNLAVQAKAAAAAAAAGHADLHSTNHH HFTYTGSGTVTPQLQITVGGTSGASTPSRSLSVPPTDETDSANNTPESIAQATAARLATLNAKLFRKPVANPLDISHAPD VELLSPEEQMLCSQLRILPKPYLAIKETLFRELLRNGGTLKKRTARELLKIDVNKTARIYEFFQSQRWIS
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
GO:0035065 regulation of histone acetylation
Molecular Function
GO:0003677 DNA binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
Cellular Component
None predicted.