Protein

MCA_04046_1

Length
523 amino acids

Gene name: GPA2

Description: Guanine nucleotide-binding protein alpha-2 subunit

Browser: contigC:1850042-1851614-

RNA-seq: read pairs 2452, FPKM 57.8, percentile rank 68.5% (100% = highest expression)

Protein function

Annotation:GPA2Guanine nucleotide-binding protein alpha-2 subunit
KEGG:K04630GNAI guanine nucleotide-binding protein G(i) subunit alpha
EGGNOG:0PFYMGPA2Guanine nucleotide-binding protein alpha-3 subunit
SGD closest match:S000000822GPA2Guanine nucleotide-binding protein alpha-2 subunit
CGD closest match:CAL0000186613GPA2Guanine nucleotide-binding protein subunit alpha

Protein alignments

%idAln lengthE-value
MIA_05845_165.84%4040.0MIA_05845_1
A0A0J9X8E1_GEOCN66.33%3950.0Similar to Saccharomyces cerevisiae YER020W GPA2 Nucleotide binding alpha subunit of the heterotrimeric G protein that interacts with the receptor Gpr1p, has signaling role in response to nutrients OS=Geotrichum candidum GN=BN980_GECA05s02738g PE=4 SV=1
A0A167F5H1_9ASCO64.56%3950.0Guanine nucleotide-binding protein subunit alpha OS=Sugiyamaella lignohabitans GN=GPA2 PE=4 SV=1
A0A060T1L1_BLAAD64.10%3903e-180ARAD1C25586p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25586g PE=4 SV=1
A0A1E3PJC6_9ASCO60.71%3972e-157G-alpha-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83388 PE=4 SV=1
Q6CHF1_YARLI55.97%4022e-155YALI0A09592p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A09592g PE=4 SV=1
UniRef50_Q6CHF155.97%4025e-152YALI0A09592p n=7 Tax=Dikarya TaxID=451864 RepID=Q6CHF1_YARLI
A0A1D8PJG1_CANAL48.14%4306e-125Guanine nucleotide-binding protein subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPA2 PE=4 SV=1
A0A1E4TJF5_9ASCO61.54%2605e-112Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_42505 PE=4 SV=1
GPA2_YEAST63.68%2342e-108Guanine nucleotide-binding protein alpha-2 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPA2 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0289

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 450 523

Detailed signature matches

  1. Family IPR001019
    Guanine nucleotide binding protein (G-protein), alpha subunit
    1. cd00066 (G-alpha)
    2. PF00503 (G-alpha)
    3. SM00275 (galpha_1)
    4. PR00318 (GPROTEINA)
  2. Family IPR002975
    Fungal G-protein, alpha subunit
    1. PR01241 (GPROTEINAFNG)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR011025
    G protein alpha subunit, helical insertion
    1. SSF47895 (Transduci...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...
  2. mobidb-lite (disord...)

Residue annotation

  1. G1 box cd00066
  2. GTP/Mg2+ binding s...
  3. GoLoco binding sit...
  4. Switch I region cd...
  5. G2 box cd00066
  6. beta - gamma compl...
  7. adenylyl cyclase i...
  8. G3 box cd00066
  9. Switch II region c...
  10. G4 box cd00066
  11. putative receptor ...
  12. G5 box cd00066

Protein sequence

>MCA_04046_1
MGSCFSKEASPPSKAPPQTQSSRVENVKAKEATQPSSAEIKANYSLNSTGNQNNNNSQNNNNNNNNNKPSDLSATSPLSG
NVKSFPPNEGPNPNSNGSKANGNTQSNSGNDGRSKTTNGVVANGNGGPSEDTSNRPEVKILLLGSGESGKSTILKQMKII
HQNGYSQEEMLMYKTTVYKNLLDCAKAIVNALEQFNINLEASSASELARPAPATTTKMIDNLDDDEEPHPNDTKVSNDEE
SSNSENNSNNHNDTSIVAEQEELIIPKITKEELEFIKNSIISPDPDSTLDPELTTIIAKLWSHPAVKNLYATKRSRFYIM
DSAPYFFNNVQRIGDVDYIPNVQDILRARIKTTGIYEIRFQMGRLNIHMYDLGGQRSERKKWIHCFDDVTVIIFCVALSE
YDQVLLEENTQNRMAESLVLFDSVINSRWFVRTSIVLFLNKIDVFTEKLPVSPLENYFPDYTGGNNIKKAAKYILWRFTQ
LNRNKLSIYPHITQATDTSNIKLVFAAIKATILQNSLKDSGLI

GO term prediction

Biological Process

GO:0007165 signal transduction
GO:0007186 G-protein coupled receptor signaling pathway

Molecular Function

GO:0001664 G-protein coupled receptor binding
GO:0003924 GTPase activity
GO:0004871 signal transducer activity
GO:0005525 GTP binding
GO:0019001 guanyl nucleotide binding
GO:0031683 G-protein beta/gamma-subunit complex binding

Cellular Component

GO:0005834 heterotrimeric G-protein complex