MCA_04046_1
Gene name: GPA2
Description: Guanine nucleotide-binding protein alpha-2 subunit
Browser: contigC:1850042-1851614-
RNA-seq: read pairs 2452, FPKM 57.8, percentile rank 68.5% (100% = highest expression)
Protein function
Annotation: | GPA2 | Guanine nucleotide-binding protein alpha-2 subunit | |
---|---|---|---|
KEGG: | K04630 | GNAI | guanine nucleotide-binding protein G(i) subunit alpha |
EGGNOG: | 0PFYM | GPA2 | Guanine nucleotide-binding protein alpha-3 subunit |
SGD closest match: | S000000822 | GPA2 | Guanine nucleotide-binding protein alpha-2 subunit |
CGD closest match: | CAL0000186613 | GPA2 | Guanine nucleotide-binding protein subunit alpha |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05845_1 | 65.84% | 404 | 0.0 | MIA_05845_1 |
A0A0J9X8E1_GEOCN | 66.33% | 395 | 0.0 | Similar to Saccharomyces cerevisiae YER020W GPA2 Nucleotide binding alpha subunit of the heterotrimeric G protein that interacts with the receptor Gpr1p, has signaling role in response to nutrients OS=Geotrichum candidum GN=BN980_GECA05s02738g PE=4 SV=1 |
A0A167F5H1_9ASCO | 64.56% | 395 | 0.0 | Guanine nucleotide-binding protein subunit alpha OS=Sugiyamaella lignohabitans GN=GPA2 PE=4 SV=1 |
A0A060T1L1_BLAAD | 64.10% | 390 | 3e-180 | ARAD1C25586p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25586g PE=4 SV=1 |
A0A1E3PJC6_9ASCO | 60.71% | 397 | 2e-157 | G-alpha-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83388 PE=4 SV=1 |
Q6CHF1_YARLI | 55.97% | 402 | 2e-155 | YALI0A09592p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A09592g PE=4 SV=1 |
UniRef50_Q6CHF1 | 55.97% | 402 | 5e-152 | YALI0A09592p n=7 Tax=Dikarya TaxID=451864 RepID=Q6CHF1_YARLI |
A0A1D8PJG1_CANAL | 48.14% | 430 | 6e-125 | Guanine nucleotide-binding protein subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPA2 PE=4 SV=1 |
A0A1E4TJF5_9ASCO | 61.54% | 260 | 5e-112 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_42505 PE=4 SV=1 |
GPA2_YEAST | 63.68% | 234 | 2e-108 | Guanine nucleotide-binding protein alpha-2 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPA2 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0289
Protein family membership
- Guanine nucleotide binding protein (G-protein), alpha subunit (IPR001019)
- Fungal G-protein, alpha subunit (IPR002975)
Domains and repeats
-
Domain
-
Domain
Detailed signature matches

-
-
mobidb-lite (disord...)
Residue annotation
-
G1 box cd00066
-
GTP/Mg2+ binding s...
-
GoLoco binding sit...
-
Switch I region cd...
-
G2 box cd00066
-
beta - gamma compl...
-
adenylyl cyclase i...
-
G3 box cd00066
-
Switch II region c...
-
G4 box cd00066
-
putative receptor ...
-
G5 box cd00066
Protein sequence
>MCA_04046_1 MGSCFSKEASPPSKAPPQTQSSRVENVKAKEATQPSSAEIKANYSLNSTGNQNNNNSQNNNNNNNNNKPSDLSATSPLSG NVKSFPPNEGPNPNSNGSKANGNTQSNSGNDGRSKTTNGVVANGNGGPSEDTSNRPEVKILLLGSGESGKSTILKQMKII HQNGYSQEEMLMYKTTVYKNLLDCAKAIVNALEQFNINLEASSASELARPAPATTTKMIDNLDDDEEPHPNDTKVSNDEE SSNSENNSNNHNDTSIVAEQEELIIPKITKEELEFIKNSIISPDPDSTLDPELTTIIAKLWSHPAVKNLYATKRSRFYIM DSAPYFFNNVQRIGDVDYIPNVQDILRARIKTTGIYEIRFQMGRLNIHMYDLGGQRSERKKWIHCFDDVTVIIFCVALSE YDQVLLEENTQNRMAESLVLFDSVINSRWFVRTSIVLFLNKIDVFTEKLPVSPLENYFPDYTGGNNIKKAAKYILWRFTQ LNRNKLSIYPHITQATDTSNIKLVFAAIKATILQNSLKDSGLI
GO term prediction
Biological Process
GO:0007165 signal transduction
GO:0007186 G-protein coupled receptor signaling pathway
Molecular Function
GO:0001664 G-protein coupled receptor binding
GO:0003924 GTPase activity
GO:0004871 signal transducer activity
GO:0005525 GTP binding
GO:0019001 guanyl nucleotide binding
GO:0031683 G-protein beta/gamma-subunit complex binding
Cellular Component
GO:0005834 heterotrimeric G-protein complex