Protein

MCA_03864_1

Length
252 amino acids

Gene name: PRE6

Description: Proteasome subunit alpha type-4

Browser: contigC:1335918-1336824-

RNA-seq: read pairs 5604, FPKM 273.7, percentile rank 91.2% (100% = highest expression)

Protein function

Annotation:PRE6Proteasome subunit alpha type-4
KEGG:K02731PSMA7 20S proteasome subunit alpha 4 [EC:3.4.25.1]
EGGNOG:0PFMYPRE6The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000005398PRE6Proteasome subunit alpha type-4
CGD closest match:CAL0000200321PRE6Proteasome endopeptidase complex

Protein alignments

%idAln lengthE-value
MIA_03133_188.89%2525e-154MIA_03133_1
A0A0J9XHP7_GEOCN83.04%2302e-142Proteasome endopeptidase complex OS=Geotrichum candidum GN=BN980_GECA17s01066g PE=3 SV=1
A0A1E3PI86_9ASCO79.65%2262e-134Proteasome endopeptidase complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46802 PE=3 SV=1
Q6CEN6_YARLI76.09%2301e-128Proteasome endopeptidase complex OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B14267g PE=3 SV=1
A0A167EJ58_9ASCO74.42%2581e-127Proteasome endopeptidase complex OS=Sugiyamaella lignohabitans GN=PRE6 PE=3 SV=1
A0A060TEC2_BLAAD74.78%2308e-127Proteasome endopeptidase complex OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D05918g PE=3 SV=1
A0A1E4T9Q6_9ASCO71.74%2302e-126Proteasome endopeptidase complex OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_146450 PE=3 SV=1
A0A1D8PSS4_CANAL72.61%2303e-126Proteasome endopeptidase complex OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE6 PE=3 SV=1
PSA4_YEAST70.09%2342e-121Proteasome subunit alpha type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE6 PE=1 SV=1
UniRef50_P4030370.09%2344e-118Proteasome subunit alpha type-4 n=197 Tax=Eukaryota TaxID=2759 RepID=PSA4_YEAST

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0495

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 252

Detailed signature matches

  1. Family IPR001353
    Proteasome, subunit alpha/beta
    1. PF00227 (Proteasome)
  2. Family IPR023332
    Proteasome alpha-type subunit
    1. PS51475 (PROTEASOME...)
  3. Domain IPR029055
    Nucleophile aminohydrolases, N-terminal
    1. G3DSA:3.60.20.10
    2. SSF56235 (N-termina...)
  4. Domain IPR000426
    Proteasome alpha-subunit, N-terminal domain
    1. PS00388 (PROTEASOME...)
    2. PF10584 (Proteasome...)
    3. SM00948 (Proteasome...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd03755 (proteasome...)

Residue annotation

  1. alpha subunit inte...
  2. active site cd03755

Protein sequence

>MCA_03864_1
MSGYDRALSVFSPDGHVFQVEYALEAVKRGTCAVAVKGGDTVIVGCEKRSALKLQDTRTTPSKINQIDSHIYLAFAGLNA
DARILIDKARVEAQSRKLTVEVPSTVEYMTKYIAGVQQRYTQSGGVRPFGVSTLVVGFDPNDKTPNLYMTEPSGIYSAWK
ANAIGRNSKTVRELLEKSYEENMSKDATIKLTLKSLLEVVQTGAKNIEIMVLEPGKAAYNLDFDTINTFVTEIEAEKEAE
AAAKKPHRSSNQ

GO term prediction

Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex