Protein

MCA_03692_1

Length
323 amino acids


Gene name: SEN34

Description: tRNA-splicing endonuclease subunit SEN34

Browser: contigC:783317-784289+

RNA-seq: read pairs 339, FPKM 12.9, percentile rank 30.8% (100% = highest expression)

Protein function

Annotation:SEN34tRNA-splicing endonuclease subunit SEN34
KEGG:K15323TSEN34 tRNA-splicing endonuclease subunit Sen34 [EC:3.1.27.9]
EGGNOG:0PN73SEN34tRNA-splicing endonuclease subunit sen-34
SGD closest match:S000000066SEN34tRNA-splicing endonuclease subunit SEN34
CGD closest match:CAL0000194258orf19.6879tRNA-splicing endonuclease subunit Sen34

Protein alignments

%idAln lengthE-value
A0A0J9X9E5_GEOCN45.25%3168e-83tRNA-splicing endonuclease subunit Sen34 OS=Geotrichum candidum GN=BN980_GECA06s00912g PE=3 SV=1
UniRef50_A0A0J9X9E545.25%3162e-79tRNA-splicing endonuclease subunit Sen34 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X9E5_GEOCN
A0A060SXM8_BLAAD43.16%3299e-71tRNA-splicing endonuclease subunit Sen34 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A05434g PE=3 SV=1
Q6C497_YARLI37.58%3147e-51tRNA-splicing endonuclease subunit Sen34 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E28600g PE=3 SV=1
A0A1E4TIE8_9ASCO33.85%3223e-42tRNA-splicing endonuclease subunit Sen34 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_55386 PE=3 SV=1
A0A167FFD6_9ASCO59.62%1048e-40tRNA splicing endonuclease subunit SEN34 OS=Sugiyamaella lignohabitans GN=SEN34 PE=4 SV=1
A0A1E3PI79_9ASCO31.71%3506e-40tRNA-intron endonuclease catalytic domain-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83191 PE=4 SV=1
MIA_03681_144.83%2031e-38MIA_03681_1
SEN34_YEAST45.71%1053e-24tRNA-splicing endonuclease subunit SEN34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN34 PE=1 SV=1
Q59T38_CANAL39.45%1099e-20tRNA-splicing endonuclease subunit Sen34 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6879 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4269

Protein family membership

Domains and repeats

1 50 100 150 200 250 323

Detailed signature matches

    1. PIRSF017250 (tRNA_e...)
    1. PF01974 (tRNA_int_endo)
    2. SSF53032 (tRNA-intr...)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_03692_1
MSQQSSSKNQLIPIHVVNRKGFIYSVESMKRLREEYNISGTLVGVLPQFPQQNVFHGMPLQLMPEEVKYLVEELKVAYLV
DDSRAHDLALWAFDPETDGINVEKYRSEIQRTQADAHKQMALMKRRKALKLDPNAPLSPEEIKILEKMDGSSAVFYEIPT
STLEVKEYLPAYSLYEQTFKDRQLNNSKNNTNTNMRQDDMNIINDGDNYETASTNSLVKVETPKDASYEIYKHLQQKGYF
LSPGLRFGGQFLAYPGDSLRYHSHFTVTGYDFNEKFKIHDLVGGGRLGTTVKKSWFVGAKSNTNNKKEEDQYYGFSVEWS
RFG

GO term prediction

Biological Process

GO:0000379 tRNA-type intron splice site recognition and cleavage
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation

Molecular Function

GO:0000213 tRNA-intron endonuclease activity

Cellular Component

GO:0000214 tRNA-intron endonuclease complex