Protein

MCA_03653_1

Length
369 amino acids


Gene name: IDH2

Description: Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial

Browser: contigC:665102-667552-

RNA-seq: read pairs 21154, FPKM 706.4, percentile rank 95.5% (100% = highest expression)

Protein function

Annotation:IDH2Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial
KEGG:K00030IDH3 isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
EGGNOG:0PFWGIDH2Isocitrate dehydrogenase
SGD closest match:S000005662IDH2Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial
CGD closest match:CAL0000183793IDH2Isocitrate dehydrogenase [NAD] subunit, mitochondrial

Protein alignments

%idAln lengthE-value
MIA_03793_190.27%3700.0MIA_03793_1
A0A0J9XJW9_GEOCN87.53%3690.0Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Geotrichum candidum GN=BN980_GECA24s00395g PE=3 SV=1
A0A1E3PUA7_9ASCO78.44%3710.0Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81394 PE=3 SV=1
Q6CA33_YARLI78.05%3690.0Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D06303g PE=3 SV=1
A0A060SXH8_BLAAD77.30%3700.0Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A03718g PE=3 SV=1
A0A1E4TLK4_9ASCO75.88%3690.0Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30738 PE=3 SV=1
A0A1D8PGS5_CANAL75.48%3670.0Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IDH2 PE=3 SV=1
A0A161HG75_9ASCO82.62%3280.0Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Sugiyamaella lignohabitans GN=IDH2 PE=3 SV=1
UniRef50_A0A161HG7582.62%3280.0Isocitrate dehydrogenase [NAD] subunit, mitochondrial n=10 Tax=Opisthokonta TaxID=33154 RepID=A0A161HG75_9ASCO
IDH2_YEAST64.21%3663e-164Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDH2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9969
Predicted cleavage: 22

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 369

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF53659 (Isocitrat...)

Protein sequence

>MCA_03653_1
MLSTRSFLRSASQALRAQRTYATSVASFTGKKNANGNYTVTLIEGDGIGPEISNAVKDIYSAAKVPIEWEPVDVTPILVD
GKTTIPKEAVDSVKRNLVALKGPLATPVGKGHVSLNLTLRRTFNLFANVRPCKSVVGFKTPYDGVDTVLIRENTEGEYSG
IEHVVVPGVVQSIKLITKPASERVLRYAFEYARSVGKKKILVVHKASIMKVSDGLFLSTAEELAKEYPDIEMSTELIDST
SLRLVTDPTPYKEYVMVMPNLYGDILSDLSSGLIGGLGLTPSGNMGDQVSIFEAVHGSAPDIAGKGLANPTALLLSSVMM
LKHMGLDQYGHKIEKAVFDTIASGPENITGDLKGTASTKKFTEEVIKRL

GO term prediction

Biological Process

GO:0006099 tricarboxylic acid cycle
GO:0055114 oxidation-reduction process

Molecular Function

GO:0000287 magnesium ion binding
GO:0004449 isocitrate dehydrogenase (NAD+) activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0051287 NAD binding

Cellular Component

None predicted.