Protein

MCA_03601_1

Length
264 amino acids

Gene name: POL30

Description: Proliferating cell nuclear antigen

Browser: contigC:481599-482469-

RNA-seq: read pairs 2212, FPKM 103.1, percentile rank 79.3% (100% = highest expression)

Protein function

Annotation:POL30Proliferating cell nuclear antigen
KEGG:K04802PCNA proliferating cell nuclear antigen
EGGNOG:0PINWPOL30This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand (By similarity)
SGD closest match:S000000292POL30Proliferating cell nuclear antigen
CGD closest match:CAL0000174634POL30Proliferating cell nuclear antigen

Protein alignments

%idAln lengthE-value
MIA_05982_166.15%2573e-124MIA_05982_1
A0A0J9X4H9_GEOCN64.23%2603e-120Proliferating cell nuclear antigen OS=Geotrichum candidum GN=BN980_GECA02s05334g PE=3 SV=1
UniRef50_A0A0J9X4H964.23%2605e-117Proliferating cell nuclear antigen n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X4H9_GEOCN
A0A1E3PF65_9ASCO55.77%2602e-99Proliferating cell nuclear antigen OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_37443 PE=3 SV=1
A0A060T0G1_BLAAD53.05%2622e-93Proliferating cell nuclear antigen OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C07392g PE=3 SV=1
Q6C9K1_YARLI55.47%2562e-91Proliferating cell nuclear antigen OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D10571g PE=3 SV=1
PCNA_YEAST46.33%2591e-74Proliferating cell nuclear antigen OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL30 PE=1 SV=1
Q5AMN0_CANAL45.38%2605e-74Proliferating cell nuclear antigen OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=POL30 PE=3 SV=1
A0A1E4TD23_9ASCO31.32%2652e-43Proliferating cell nuclear antigen OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4296 PE=3 SV=1
A0A167DE24_9ASCO48.23%1416e-36Proliferating cell nuclear antigen OS=Sugiyamaella lignohabitans GN=POL30 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1737

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 264

Detailed signature matches

  1. Family IPR000730
    Proliferating cell nuclear antigen, PCNA
    1. TIGR00590
    2. MF_00317 (DNApol_cl...)
    3. PR00339 (PCNACYCLIN)
  2. Domain IPR022648
    Proliferating cell nuclear antigen, PCNA, N-terminal
    1. PF00705 (PCNA_N)
  3. Domain IPR022649
    Proliferating cell nuclear antigen, PCNA, C-terminal
    1. PF02747 (PCNA_C)
  4. SITE IPR022659
    Proliferating cell nuclear antigen, PCNA, conserved site
    1. PS01251 (PCNA_1)
    2. PS00293 (PCNA_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.70.10.10
  2. SSF55979 (DNA clamp)
  3. cd00577 (PCNA)

Residue annotation

  1. putative DNA bindi...
  2. PCNA/WAF1-CIP1 pro...
  3. PCNA/FEN-1 protein...
  4. trimer interface c...
  5. PCNA/RFCL protein ...

Protein sequence

>MCA_03601_1
MLEAKLQEAGVFKRIVESIKDLVKHCNFDCSEEGISIQAIDESHIALVSMQLGIDAFSSYRCDRTIPLGLNIDSLMKVLK
SANSNDVLTLRAEDNGDVLTLVFEDANNSDRISEYNIKLMNIDQDHLSIPDTEYTTTIKMPSSEYQRIARDLSVLSESMT
ISASKEGARFFSEGEFGSGSISLKPTSDLSDDEKSIEISAEEPVSLGFNMKYLLQTCKAGSLAPRVFLYMSPGIPILVSY
KLPSGHLNFYLAPKISDEDEEEES

GO term prediction

Biological Process

GO:0006275 regulation of DNA replication

Molecular Function

GO:0003677 DNA binding
GO:0030337 DNA polymerase processivity factor activity

Cellular Component

None predicted.