Protein
MCA_03601_1
Length
264 amino acids
Gene name: POL30
Description: Proliferating cell nuclear antigen
Browser: contigC:481599-482469-
RNA-seq: read pairs 2212, FPKM 103.1, percentile rank 79.3% (100% = highest expression)
Protein function
Annotation: | POL30 | Proliferating cell nuclear antigen | |
---|---|---|---|
KEGG: | K04802 | PCNA | proliferating cell nuclear antigen |
EGGNOG: | 0PINW | POL30 | This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand (By similarity) |
SGD closest match: | S000000292 | POL30 | Proliferating cell nuclear antigen |
CGD closest match: | CAL0000174634 | POL30 | Proliferating cell nuclear antigen |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05982_1 | 66.15% | 257 | 3e-124 | MIA_05982_1 |
A0A0J9X4H9_GEOCN | 64.23% | 260 | 3e-120 | Proliferating cell nuclear antigen OS=Geotrichum candidum GN=BN980_GECA02s05334g PE=3 SV=1 |
UniRef50_A0A0J9X4H9 | 64.23% | 260 | 5e-117 | Proliferating cell nuclear antigen n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X4H9_GEOCN |
A0A1E3PF65_9ASCO | 55.77% | 260 | 2e-99 | Proliferating cell nuclear antigen OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_37443 PE=3 SV=1 |
A0A060T0G1_BLAAD | 53.05% | 262 | 2e-93 | Proliferating cell nuclear antigen OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C07392g PE=3 SV=1 |
Q6C9K1_YARLI | 55.47% | 256 | 2e-91 | Proliferating cell nuclear antigen OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D10571g PE=3 SV=1 |
PCNA_YEAST | 46.33% | 259 | 1e-74 | Proliferating cell nuclear antigen OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL30 PE=1 SV=1 |
Q5AMN0_CANAL | 45.38% | 260 | 5e-74 | Proliferating cell nuclear antigen OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=POL30 PE=3 SV=1 |
A0A1E4TD23_9ASCO | 31.32% | 265 | 2e-43 | Proliferating cell nuclear antigen OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4296 PE=3 SV=1 |
A0A167DE24_9ASCO | 48.23% | 141 | 6e-36 | Proliferating cell nuclear antigen OS=Sugiyamaella lignohabitans GN=POL30 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1737
Protein family membership
- Proliferating cell nuclear antigen, PCNA (IPR000730)
Domains and repeats
-
Domain
1
50
100
150
200
264
Detailed signature matches

Unintegrated signatures
Residue annotation
-
putative DNA bindi...
-
PCNA/WAF1-CIP1 pro...
-
PCNA/FEN-1 protein...
-
trimer interface c...
-
PCNA/RFCL protein ...
Protein sequence
>MCA_03601_1 MLEAKLQEAGVFKRIVESIKDLVKHCNFDCSEEGISIQAIDESHIALVSMQLGIDAFSSYRCDRTIPLGLNIDSLMKVLK SANSNDVLTLRAEDNGDVLTLVFEDANNSDRISEYNIKLMNIDQDHLSIPDTEYTTTIKMPSSEYQRIARDLSVLSESMT ISASKEGARFFSEGEFGSGSISLKPTSDLSDDEKSIEISAEEPVSLGFNMKYLLQTCKAGSLAPRVFLYMSPGIPILVSY KLPSGHLNFYLAPKISDEDEEEES
GO term prediction
Biological Process
GO:0006275 regulation of DNA replication
Molecular Function
GO:0003677 DNA binding
GO:0030337 DNA polymerase processivity factor activity
Cellular Component
None predicted.