Protein

MCA_03423_1

Length
327 amino acids

Gene name: ZTA1

Description: Probable quinone oxidoreductase

Browser: contigB:4392640-4393624+

RNA-seq: read pairs 6116, FPKM 230.4, percentile rank 89.6% (100% = highest expression)

Protein function

Annotation:ZTA1Probable quinone oxidoreductase
KEGG:K00344qor NADPH2:quinone reductase [EC:1.6.5.5]
EGGNOG:0PFIWZTA1Quinone oxidoreductase
SGD closest match:S000000250ZTA1Probable quinone oxidoreductase
CGD closest match:CAL0000175885orf19.2262NADPH:quinone reductase

Protein alignments

%idAln lengthE-value
MIA_03880_171.83%3231e-174MIA_03880_1
A0A060TAN2_BLAAD57.67%3263e-133ARAD1D20988p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D20988g PE=4 SV=1
A0A0J9X5L3_GEOCN54.29%3264e-128Similar to Saccharomyces cerevisiae YBR046C ZTA1 NADPH-dependent quinone reductase OS=Geotrichum candidum GN=BN980_GECA02s05213g PE=4 SV=1
UniRef50_A0A0J9X5L354.29%3269e-125Similar to Saccharomyces cerevisiae YBR046C ZTA1 NADPH-dependent quinone reductase n=72 Tax=Dikarya TaxID=451864 RepID=A0A0J9X5L3_GEOCN
A0A167EY42_9ASCO55.62%3292e-119Zta1p OS=Sugiyamaella lignohabitans GN=ZTA1 PE=4 SV=1
Q59Z38_CANAL49.70%3322e-110NADPH:quinone reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2262 PE=4 SV=1
QOR_YEAST50.15%3251e-110Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1
A0A1E3PMT2_9ASCO49.39%3301e-106NAD(P)-binding protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82990 PE=4 SV=1
A0A1E4TC10_9ASCO48.60%3213e-100Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_137045 PE=4 SV=1
Q6CEW4_YARLI28.35%3215e-26YALI0B12386p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B12386g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0715

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 250 300 327

Detailed signature matches

  1. Domain IPR011032
    GroES-like
    1. SSF50129 (GroES-like)
  2. Domain IPR020843
    Polyketide synthase, enoylreductase domain
    1. SM00829 (PKS_ER_nam...)
  3. Domain IPR013154
    Alcohol dehydrogenase, N-terminal
    1. PF08240 (ADH_N)
  4. Domain IPR016040
    NAD(P)-binding domain
    1. SSF51735 (NAD(P)-bi...)
  5. Domain IPR013149
    Alcohol dehydrogenase, C-terminal
    1. PF00107 (ADH_zinc_N)
  6. SITE IPR002364
    Quinone oxidoreductase/zeta-crystallin, conserved site
    1. PS01162 (QOR_ZETA_C...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.90.18...
  2. cd05286 (QOR2)

Residue annotation

  1. NADP binding site ...
  2. dimer interface cd...

Protein sequence

>MCA_03423_1
MATTQKAVRIHKTGDFDVVQIDTDVPVPEVAENEILVKNKYAGVNFIENYFRIGLYPATYPLTLGREASGEVVKVGSKVT
RFAVGDRVAYTLPEAYAQYTVMNQNSKVVKIPENVDYKTAAAILIQGLTALTMTKESYEVKSGDYILVHAAAGGTGSLIT
QIASKIGAHVIGSVSTPEKAEIAKANGAEFVINYKEEDVVRRVAEITNGEGVAACFDGVGKSTYDTSIACLARKGTMVSF
GNASGAVPPISLLSLSAKNLKILRPTLFNYVSTPSEWKYYSDLIFKMLDEGDIKINISKIYPLEEAKQALQDISSGKTTG
KLLLEIN

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0008270 zinc ion binding
GO:0016491 oxidoreductase activity

Cellular Component

None predicted.