Protein

MCA_03289_1

Length
222 amino acids

Description: protein with ribonuclease H domain

Browser: contigB:3920219-3920888-

RNA-seq: read pairs 388, FPKM 21.5, percentile rank 43.3% (100% = highest expression)

Protein function

Annotation:protein with ribonuclease H domain
KEGG:K03469rnhA ribonuclease HI [EC:3.1.26.4]
CGD closest match:CAL0000184579orf19.5564Uncharacterized protein

Protein alignments

%idAln lengthE-value
UniRef50_A0A1I7TF6432.50%1602e-09Uncharacterized protein n=1 Tax=Caenorhabditis tropicalis TaxID=1561998 RepID=A0A1I7TF64_9PELO
MIA_01559_131.79%1513e-10MIA_01559_1
A0A060TD98_BLAAD28.03%1571e-07Ribonuclease H OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D41536g PE=3 SV=1
A0A1D8PQ03_CANAL27.39%1579e-07Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5564 PE=4 SV=1
A0A1E3PU38_9ASCO33.68%958e-06Ribonuclease H OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49110 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6805
Predicted cleavage: 39

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 222

Detailed signature matches

  1. Domain IPR012337
    Ribonuclease H-like domain
    1. SSF53098 (Ribonucle...)
    2. G3DSA:3.30.42...
  2. Domain IPR002156
    Ribonuclease H domain
    1. PF00075 (RNase_H)
    2. PS50879 (RNASE_H)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_03289_1
MSKIPFFIRSETFTLFYKKVVSFLTPAQKVFTDGSRRQNGKAGYGIWYGRDHERNIGQPICPKKHGALTSRQVEDFAIYK
ALLRESQRKEIPPKLIIYTDSAASIRLLVLPKPKLSPKDKYIIQSAYLVKTLEQKGCRTIFRYVRGHSQIEGNVGAHKLA
YQAAKRLPPSQITNSKSSELSKSAEPSKSSKFEEPSKSSKTSKSTGLLKLLQPSEPFKNQTL

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

Cellular Component

None predicted.