Protein
MCA_03106_1
Length
320 amino acids
Gene name: PHO85
Description: Cyclin-dependent kinase; in S. cerevusiae involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle
Browser: contigB:3388785-3389888+
RNA-seq: read pairs 2399, FPKM 92.3, percentile rank 77.3% (100% = highest expression)
Protein function
| Annotation: | PHO85 | Cyclin-dependent kinase; in S. cerevusiae involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle | |
|---|---|---|---|
| EGGNOG: | 0PGBA | PHO85 | Negative regulator of the PHO system |
| SGD closest match: | S000005952 | PHO85 | Cyclin-dependent protein kinase PHO85 |
| CGD closest match: | CAL0000200290 | PHO85 | Cyclin-dependent serine/threonine-protein kinase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| PHO85_YARLI | 84.69% | 294 | 0.0 | Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 |
| A0A0J9XGK4_GEOCN | 83.06% | 301 | 0.0 | Similar to Saccharomyces cerevisiae YGR040W KSS1 Mitogen-activated protein kinase (MAPK) involved in signal transduction pathways that control filamentous growth and pheromone response OS=Geotrichum candidum GN=BN980_GECA16s01341g PE=3 SV=1 |
| MIA_04336_1 | 78.55% | 317 | 2e-177 | MIA_04336_1 |
| A0A1E3PJF6_9ASCO | 82.59% | 293 | 1e-175 | Negative regulator of the PHO system OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_42361 PE=3 SV=1 |
| UniRef50_K0L0C6 | 77.89% | 294 | 2e-163 | Negative regulator of the PHO system n=14 Tax=Opisthokonta TaxID=33154 RepID=K0L0C6_WICCF |
| A0A1E4TCM4_9ASCO | 75.17% | 294 | 1e-165 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_140099 PE=3 SV=1 |
| A0A1D8PDA6_CANAL | 77.85% | 289 | 7e-163 | Cyclin-dependent serine/threonine-protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHO85 PE=3 SV=1 |
| PHO85_YEAST | 70.76% | 301 | 1e-147 | Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 |
| A0A167FJB1_9ASCO | 81.22% | 245 | 7e-144 | Cyclin-dependent serine/threonine-protein kinase PHO85 OS=Sugiyamaella lignohabitans GN=PHO85 PE=4 SV=1 |
| A0A060T399_BLAAD | 80.43% | 235 | 6e-137 | ARAD1C30976p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C30976g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0892
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
50
100
150
200
250
320
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_03106_1 MSTSSQFQQLEKLGEGTYATVYKGKNKSTGQLVALKEINLDSEEGTPSTAIREISLMKELKHPNIVRLYDVIHTENKLNL VFEYMDKDLKKYMDTTGKRGALDAPTVKHFMYQLLKGILFCHDNRVLHRDLKPQNLLINSRGHLKLADFGLARAFGIPVN TFSNEVVTLWYRAPDVLLGSRTYSTSIDIWSAGCILAEMFTGRPLFAGNSNDDQLQKIFKIMGTPNEATWPGISQLPNYN PSFPQYAPQDLRVIIPQIDSQALDLLQALLRMKPESRISAGEALQHPWFAEYNQQQVQYPMANNMGVQGEYQQQVMQPQY
GO term prediction
Biological Process
GO:0006468 protein phosphorylation
Molecular Function
GO:0004672 protein kinase activity
GO:0005524 ATP binding
Cellular Component
None predicted.