Protein

MCA_03055_1

Length
394 amino acids

Gene name: MSW1

Description: Tryptophan--tRNA ligase, mitochondrial

Browser: contigB:3213502-3214687+

RNA-seq: read pairs 1613, FPKM 50.5, percentile rank 65.6% (100% = highest expression)

Protein function

Annotation:MSW1Tryptophan--tRNA ligase, mitochondrial
KEGG:K01867WARS tryptophanyl-tRNA synthetase [EC:6.1.1.2]
EGGNOG:0PGYSMSW1Tryptophanyl-tRNA synthetase
SGD closest match:S000002676MSW1Tryptophan--tRNA ligase, mitochondrial
CGD closest match:CAL0000182517MSW1Tryptophan--tRNA ligase

Protein alignments

%idAln lengthE-value
MIA_04800_169.57%3910.0MIA_04800_1
A0A0J9X5Z4_GEOCN64.87%3906e-178Similar to Saccharomyces cerevisiae YDR268W MSW1 Mitochondrial tryptophanyl-tRNA synthetase OS=Geotrichum candidum GN=BN980_GECA02s07061g PE=3 SV=1
A0A167DEB1_9ASCO57.22%3811e-153Tryptophan--tRNA ligase MSW1 OS=Sugiyamaella lignohabitans GN=MSW1 PE=3 SV=1
A0A060T057_BLAAD56.48%3865e-148ARAD1C13970p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C13970g PE=3 SV=1
UniRef50_A3LVM547.95%3901e-122Mitochondrial tryptophanyl-tRNA synthetase n=43 Tax=Saccharomycetales TaxID=4892 RepID=A3LVM5_PICST
Q6CBI6_YARLI50.39%3834e-126YALI0C18425p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C18425g PE=3 SV=1
A0A1E3PI03_9ASCO48.84%3891e-123Tryptophanyl-tRNA synthetase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_42344 PE=3 SV=1
Q5AG80_CANAL48.38%3703e-119Tryptophan--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MSW1 PE=3 SV=1
SYWM_YEAST45.36%3776e-111Tryptophan--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSW1 PE=1 SV=2
A0A1E4TK09_9ASCO40.77%3631e-89Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_643 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.5816

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 394

Detailed signature matches

  1. Family IPR002305
    Aminoacyl-tRNA synthetase, class Ic
    1. PF00579 (tRNA-synt_1b)
  2. Family IPR002306
    Tryptophan-tRNA ligase
    1. cd00806 (TrpRS_core)
    2. PR01039 (TRNASYNTHTRP)
    3. TIGR00233
  3. Family IPR024109
    Tryptophan-tRNA ligase, bacterial-type
    1. MF_00140_B (Trp_tRN...)
  4. Domain IPR014729
    Rossmann-like alpha/beta/alpha sandwich fold
    1. G3DSA:3.40.50...
  5. SITE IPR001412
    Aminoacyl-tRNA synthetase, class I, conserved site
    1. PS00178 (AA_TRNA_LI...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.24...
  2. SSF52374 (Nucleotid...)

Residue annotation

  1. active site cd00806
  2. HIGH motif cd00806
  3. dimer interface cd...
  4. KMSKS motif cd00806

Protein sequence

>MCA_03055_1
MASTVAKAAGKVAKDTVLNMASTSVPAKSSVFSMIQPTGVFHVGNYLGAVKSWVDIQNKAKQDHPDVADRPKLLFGVADL
HALTIPKDPKTLKFTRMQAIASMLATGLDPEVCIIFQQSRIPEHTQLYWLLSTITGMGYLNRMTQWKSKIHLDDSASLLS
TSEESAKALASLNLGLFAYPCLQAADILLYKAGYVPVGEDQGQHLELSRHICNTFNKQYPGISTNSKGKLEKKPIFPVPK
TIFAPFKKVLSLRDPSKKMSKSDPDQTSCIYIPDSPEKIQKSVRRAVTDSIQGPVTYDPVNRPGIANLLDMASGILDKTP
QEVLNTINPQDHKSFKDGIAGILIEGLKPVREEYERLMNDPEYIEEVTQKGTIKAREIAIQTMKEVNAAVGLDY

GO term prediction

Biological Process

GO:0006418 tRNA aminoacylation for protein translation
GO:0006436 tryptophanyl-tRNA aminoacylation

Molecular Function

GO:0000166 nucleotide binding
GO:0004812 aminoacyl-tRNA ligase activity
GO:0004830 tryptophan-tRNA ligase activity
GO:0005524 ATP binding

Cellular Component

GO:0005737 cytoplasm