MCA_03055_1
Gene name: MSW1
Description: Tryptophan--tRNA ligase, mitochondrial
Browser: contigB:3213502-3214687+
RNA-seq: read pairs 1613, FPKM 50.5, percentile rank 65.6% (100% = highest expression)
Protein function
| Annotation: | MSW1 | Tryptophan--tRNA ligase, mitochondrial | |
|---|---|---|---|
| KEGG: | K01867 | WARS | tryptophanyl-tRNA synthetase [EC:6.1.1.2] |
| EGGNOG: | 0PGYS | MSW1 | Tryptophanyl-tRNA synthetase |
| SGD closest match: | S000002676 | MSW1 | Tryptophan--tRNA ligase, mitochondrial |
| CGD closest match: | CAL0000182517 | MSW1 | Tryptophan--tRNA ligase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04800_1 | 69.57% | 391 | 0.0 | MIA_04800_1 |
| A0A0J9X5Z4_GEOCN | 64.87% | 390 | 6e-178 | Similar to Saccharomyces cerevisiae YDR268W MSW1 Mitochondrial tryptophanyl-tRNA synthetase OS=Geotrichum candidum GN=BN980_GECA02s07061g PE=3 SV=1 |
| A0A167DEB1_9ASCO | 57.22% | 381 | 1e-153 | Tryptophan--tRNA ligase MSW1 OS=Sugiyamaella lignohabitans GN=MSW1 PE=3 SV=1 |
| A0A060T057_BLAAD | 56.48% | 386 | 5e-148 | ARAD1C13970p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C13970g PE=3 SV=1 |
| UniRef50_A3LVM5 | 47.95% | 390 | 1e-122 | Mitochondrial tryptophanyl-tRNA synthetase n=43 Tax=Saccharomycetales TaxID=4892 RepID=A3LVM5_PICST |
| Q6CBI6_YARLI | 50.39% | 383 | 4e-126 | YALI0C18425p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C18425g PE=3 SV=1 |
| A0A1E3PI03_9ASCO | 48.84% | 389 | 1e-123 | Tryptophanyl-tRNA synthetase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_42344 PE=3 SV=1 |
| Q5AG80_CANAL | 48.38% | 370 | 3e-119 | Tryptophan--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MSW1 PE=3 SV=1 |
| SYWM_YEAST | 45.36% | 377 | 6e-111 | Tryptophan--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSW1 PE=1 SV=2 |
| A0A1E4TK09_9ASCO | 40.77% | 363 | 1e-89 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_643 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5816
Protein family membership
- Aminoacyl-tRNA synthetase, class Ic (IPR002305)
- Tryptophan-tRNA ligase (IPR002306)
- Tryptophan-tRNA ligase, bacterial-type (IPR024109)
- Tryptophan-tRNA ligase (IPR002306)
Domains and repeats
-
Domain
Detailed signature matches
-
-
PF00579 (tRNA-synt_1b)
-
-
-
MF_00140_B (Trp_tRN...)
-
-
-
PS00178 (AA_TRNA_LI...)
-
no IPR
-
-
SSF52374 (Nucleotid...)
Residue annotation
-
active site cd00806
-
HIGH motif cd00806
-
dimer interface cd...
-
KMSKS motif cd00806
Protein sequence
>MCA_03055_1 MASTVAKAAGKVAKDTVLNMASTSVPAKSSVFSMIQPTGVFHVGNYLGAVKSWVDIQNKAKQDHPDVADRPKLLFGVADL HALTIPKDPKTLKFTRMQAIASMLATGLDPEVCIIFQQSRIPEHTQLYWLLSTITGMGYLNRMTQWKSKIHLDDSASLLS TSEESAKALASLNLGLFAYPCLQAADILLYKAGYVPVGEDQGQHLELSRHICNTFNKQYPGISTNSKGKLEKKPIFPVPK TIFAPFKKVLSLRDPSKKMSKSDPDQTSCIYIPDSPEKIQKSVRRAVTDSIQGPVTYDPVNRPGIANLLDMASGILDKTP QEVLNTINPQDHKSFKDGIAGILIEGLKPVREEYERLMNDPEYIEEVTQKGTIKAREIAIQTMKEVNAAVGLDY
GO term prediction
Biological Process
GO:0006418 tRNA aminoacylation for protein translation
GO:0006436 tryptophanyl-tRNA aminoacylation
Molecular Function
GO:0000166 nucleotide binding
GO:0004812 aminoacyl-tRNA ligase activity
GO:0004830 tryptophan-tRNA ligase activity
GO:0005524 ATP binding
Cellular Component
GO:0005737 cytoplasm