Protein

MCA_03036_2

Length
82 amino acids


Browser: contigB:3160343-3161034+

RNA-seq: read pairs 26513, FPKM 3946.9, percentile rank 99.1% (100% = highest expression)

Protein function

KEGG:K02978RP-S27e small subunit ribosomal protein S27e
EGGNOG:0PQK4RPS2740S ribosomal protein S27
SGD closest match:S000001063RPS27B40S ribosomal protein S27-B
CGD closest match:CAL0000200692RPS2740S ribosomal protein S27

Protein alignments

%idAln lengthE-value
MIA_02688_192.59%813e-50MIA_02688_1
B5FVG8_YARLI87.80%824e-5040S ribosomal protein S27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E34826g PE=3 SV=1
UniRef50_A0A0K8LBA787.65%812e-4340S ribosomal protein S27 n=2 Tax=Eurotiomycetidae TaxID=451871 RepID=A0A0K8LBA7_9EURO
A0A0F7RQA3_GEOCN89.02%826e-4940S ribosomal protein S27 OS=Geotrichum candidum GN=BN980_GECA01s04377g PE=3 SV=1
A0A1E3PJ28_9ASCO79.27%826e-46Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_70878 PE=3 SV=1
A0A1D8PTI7_CANAL84.15%821e-4540S ribosomal protein S27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS27 PE=3 SV=1
A0A060TD60_BLAAD81.71%823e-4540S ribosomal protein S27 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D45386g PE=3 SV=1
RS27B_YEAST80.49%824e-4440S ribosomal protein S27-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS27B PE=1 SV=1
A0A1E4TDS7_9ASCO68.29%824e-3840S ribosomal protein S27 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_56555 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0186

Protein family membership

Domains and repeats

1 10 20 30 40 50 60 70 82

Detailed signature matches

    1. MF_00371 (Ribosomal...)
    2. PF01667 (Ribosomal_...)
    3. PS01168 (RIBOSOMAL_...)
    1. SSF57829 (Zn-bindin...)

Protein sequence

>MCA_03036_2
MVLAQDLLNPTPQAEAKKHKLKTLVPAPRSFFMDVKCPGCLAITTVFSHAQTVVTCGSCSNVLCTPTGGKAKLTEGCSFR
RK

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome