Protein

MIA_02688_1

Length
81 amino acids

Browser: contig03:1458708-1459004-

Protein function

EGGNOG:0Q16940S ribosomal protein S27
SGD closest match:S000001063RPS27B40S ribosomal protein S27-B
CGD closest match:CAL0000200692RPS2740S ribosomal protein S27

Protein alignments

%idAln lengthE-value
UniRef50_A0A146FQX586.420%815.37e-4440S ribosomal protein S27 n=5 Tax=Aspergillaceae TaxID=1131492 RepID=A0A146FQX5_9EURO
B5FVG8_YARLI86.420%813.00e-4940S ribosomal protein S27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E34826g PE=3 SV=1
A0A0F7RQA3_GEOCN86.420%812.66e-4740S ribosomal protein S27 OS=Geotrichum candidum GN=BN980_GECA01s04377g PE=3 SV=1
A0A060TD60_BLAAD80.247%812.89e-4440S ribosomal protein S27 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D45386g PE=3 SV=1
A0A1E3PJ28_9ASCO75.309%813.51e-43Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_70878 PE=3 SV=1
A0A1D8PTI7_CANAL77.778%812.38e-4240S ribosomal protein S27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS27 PE=3 SV=1
RS27B_YEAST76.543%811.94e-4140S ribosomal protein S27-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS27B PE=1 SV=1
A0A1E4TDS7_9ASCO68.750%807.62e-3740S ribosomal protein S27 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_56555 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0257

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 81

Detailed signature matches

  1. Family IPR000592
    Ribosomal protein S27e
    1. PD004466
    2. MF_00371 (Ribosomal...)
    3. PS01168 (RIBOSOMAL_...)
    4. PF01667 (Ribosomal_...)
  2. Domain IPR011332
    Zinc-binding ribosomal protein
    1. SSF57829 (Zn-bindin...)
  3. Domain IPR023407
    Ribosomal protein S27e, zinc-binding domain
    1. G3DSA:2.20.25...

Protein sequence

>MIA_02688_1
MLAFYLLNPTPQAEARKHKLKTLVPAPRSFFMDVKCPGCLSITTVFSHAQTVVTCGSCSNVLCQPTGGKAKLTEGCSFRR
K

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome