Protein

MCA_02895_1

Length
307 amino acids

Gene name: CDC28

Description: Cyclin-dependent kinase 1; master regulator of mitotic and meiotic cell cycles

Browser: contigB:2669528-2670570+

RNA-seq: read pairs 2285, FPKM 91.7, percentile rank 77.2% (100% = highest expression)

Protein function

Annotation:CDC28Cyclin-dependent kinase 1; master regulator of mitotic and meiotic cell cycles
KEGG:K04563CDC28 cyclin-dependent kinase [EC:2.7.11.22]
EGGNOG:0PFG7CDC28Cell division control protein
SGD closest match:S000000364CDC28Cyclin-dependent kinase 1
CGD closest match:CAL0000191263CDC28Cyclin-dependent kinase 1

Protein alignments

%idAln lengthE-value
MIA_01070_187.50%2960.0MIA_01070_1
A0A0J9XJQ0_GEOCN81.33%3000.0Similar to Saccharomyces cerevisiae YBR160W CDC28 Catalytic subunit of the main cell cycle cyclin-dependent kinase (CDK) OS=Geotrichum candidum GN=BN980_GECA24s00846g PE=3 SV=1
A0A060T6N5_BLAAD78.08%2925e-176ARAD1B16962p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B16962g PE=3 SV=1
Q6CF29_YARLI77.74%2924e-171YALI0B10758p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B10758g PE=3 SV=1
CDK1_CANAL76.71%2921e-169Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1
A0A1E4TIQ8_9ASCO76.51%2987e-170Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_73709 PE=3 SV=1
A0A1E3PJQ3_9ASCO72.22%2889e-164Pkinase-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52026 PE=3 SV=1
UniRef50_Q0064666.67%3214e-154Cyclin-dependent kinase 1 n=268 Tax=Eukaryota TaxID=2759 RepID=CDK1_EMENI
CDK1_YEAST69.49%2953e-155Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1
A0A167FLB6_9ASCO72.76%2468e-131Cyclin-dependent serine/threonine-protein kinase CDC28 OS=Sugiyamaella lignohabitans GN=CDC28 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0816

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 307

Detailed signature matches

  1. Domain IPR011009
    Protein kinase-like domain
    1. SSF56112 (Protein k...)
  2. Domain IPR000719
    Protein kinase domain
    1. PS50011 (PROTEIN_KI...)
    2. PF00069 (Pkinase)
    3. SM00220 (serkin_6)
  3. SITE IPR017441
    Protein kinase, ATP binding site
    1. PS00107 (PROTEIN_KI...)
  4. SITE IPR008271
    Serine/threonine-protein kinase, active site
    1. PS00108 (PROTEIN_KI...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.51...
  2. G3DSA:3.30.20...
  3. PIRSF000654 (ILK)
  4. cd07835 (STKc_CDK1_...)

Residue annotation

  1. ATP binding site c...
  2. active site cd07835
  3. CDK/cyclin interfa...
  4. polypeptide substr...
  5. activation loop (A...

Protein sequence

>MCA_02895_1
MGDLSDYTKLEKVGEGTYGVVYKARDIKHGNRLVALKKIRLEAEDEGVPSTAIREISLLKEMRNENIVALHNIVHTDSQK
LYLVFEFLDMDFKKYMETIKTGEGLDANVIKRFMSQLIKGICYCHSHRILHRDLKPQNLLIDKEGNLKIADFGLARAFGV
PLRSYTHEVVTLWYRAPEILLGGKQYSVGIDMWSIGCIFAEMITRKALFPGDSEIDEIFKIFQVLGTPTEEIWPGVTALP
NFKSTFPQWTKQKLDTHVPGLDEYSSDLLHSLLQYDPALRISAKRCLQHPYFTDYKNNSALSNNDQS

GO term prediction

Biological Process

GO:0006468 protein phosphorylation

Molecular Function

GO:0004672 protein kinase activity
GO:0005524 ATP binding

Cellular Component

None predicted.