Protein
MCA_02823_1
Length
141 amino acids
Gene name: HTB1
Description: Histone H2B.1
Browser: contigB:2460895-2461321+
RNA-seq: read pairs 15716, FPKM 1367.5, percentile rank 97.2% (100% = highest expression)
Protein function
| Annotation: | HTB1 | Histone H2B.1 | |
|---|---|---|---|
| KEGG: | K11252 | H2B | histone H2B |
| EGGNOG: | 0PNT7 | HTB1 | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling |
| SGD closest match: | S000002632 | HTB1 | Histone H2B.1 |
| CGD closest match: | CAL0000196000 | HTB1 | Histone H2B.1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XAL7_GEOCN | 94.23% | 104 | 4e-68 | Histone H2B OS=Geotrichum candidum GN=BN980_GECA07s01176g PE=3 SV=1 |
| MIA_01799_1 | 94.23% | 104 | 1e-67 | MIA_01799_1 |
| A0A060T075_BLAAD | 92.31% | 104 | 5e-67 | Histone H2B OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C14366g PE=3 SV=1 |
| A0A167D9K5_9ASCO | 90.38% | 104 | 5e-66 | Histone H2B OS=Sugiyamaella lignohabitans GN=HTB1 PE=3 SV=1 |
| A0A1E4TCP2_9ASCO | 88.35% | 103 | 8e-64 | Histone H2B OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4158 PE=3 SV=1 |
| H2B1_CANAL | 91.84% | 98 | 1e-62 | Histone H2B.1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTB1 PE=3 SV=3 |
| UniRef50_Q6CK60 | 89.80% | 98 | 3e-58 | Histone H2B.1 n=160 Tax=Eukaryota TaxID=2759 RepID=H2B1_KLULA |
| A0A1E3PTP5_9ASCO | 84.62% | 104 | 3e-61 | Histone-fold-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45147 PE=3 SV=1 |
| H2B1_YEAST | 87.76% | 98 | 2e-60 | Histone H2B.1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTB1 PE=1 SV=2 |
| H2B_YARLI | 87.00% | 100 | 3e-60 | Histone H2B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HTB1 PE=3 SV=3 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0217
Protein family membership
- Histone H2B (IPR000558)
Domains and repeats
-
Domain
1
20
40
60
80
100
120
141
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_02823_1 MAPKPAEKKPASKAPAGKAPVSSEKKGSEAGKKTTSSAVGGEKKKRTKARKQTYSSYIYKVLKQTHPDTGISTRAMSIMN SFVNDIFERIATESSKLAAYNKRSTISSREIQTAVRLILPGELAKHAISEGTRAVTKYTSA
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0003677 DNA binding
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome