Protein
MCA_02522_1
Length
93 amino acids
Gene name: TIM8
Description: Mitochondrial import inner membrane translocase subunit TIM8
Browser: contigB:1555687-1556148+
RNA-seq: read pairs 3202, FPKM 420.9, percentile rank 93.7% (100% = highest expression)
Protein function
| Annotation: | TIM8 | Mitochondrial import inner membrane translocase subunit TIM8 | |
|---|---|---|---|
| KEGG: | K17780 | TIM8 | mitochondrial import inner membrane translocase subunit TIM8 |
| EGGNOG: | 0PQY8 | TIM8 | Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins |
| SGD closest match: | S000007348 | TIM8 | Mitochondrial import inner membrane translocase subunit TIM8 |
| CGD closest match: | CAL0000198973 | TIM8 | Mitochondrial import inner membrane translocase subunit TIM8 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03295_1 | 78.41% | 88 | 3e-47 | MIA_03295_1 |
| A0A060T452_BLAAD | 67.86% | 84 | 3e-38 | ARAD1A14278p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A14278g PE=3 SV=1 |
| A0A1E3PM95_9ASCO | 65.88% | 85 | 5e-37 | Mitochondrial import inner membrane translocase subunit TIM8 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82340 PE=3 SV=1 |
| UniRef50_A0A061AQW9 | 66.25% | 80 | 4e-31 | CYFA0S04e01486g1_1 n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A061AQW9_CYBFA |
| TIM8_YEAST | 62.64% | 91 | 3e-33 | Mitochondrial import inner membrane translocase subunit TIM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM8 PE=1 SV=1 |
| TIM8_CANAL | 61.11% | 90 | 3e-32 | Mitochondrial import inner membrane translocase subunit TIM8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM8 PE=3 SV=2 |
| Q6C9F7_YARLI | 55.00% | 80 | 6e-29 | YALI0D11572p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D11572g PE=3 SV=2 |
| A0A1E4TEN8_9ASCO | 50.59% | 85 | 2e-28 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_103059 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0468
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
10
20
30
40
50
60
70
80
93
Detailed signature matches
Protein sequence
>MCA_02522_1 MSSASTSIDSQALANLDTTTRKEIVDWIEAENSKSKVQMSIHNFTDMCFKKCITKVNSSTLDSQEESCLSNCLNRFLDTN INIVKMIQQSQGH
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.