Protein

MCA_02522_1

Length
93 amino acids


Gene name: TIM8

Description: Mitochondrial import inner membrane translocase subunit TIM8

Browser: contigB:1555687-1556148+

RNA-seq: read pairs 3202, FPKM 420.9, percentile rank 93.7% (100% = highest expression)

Protein function

Annotation:TIM8Mitochondrial import inner membrane translocase subunit TIM8
KEGG:K17780TIM8 mitochondrial import inner membrane translocase subunit TIM8
EGGNOG:0PQY8TIM8Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIM8-TIM13 complex is non essential and only mediates the import of few proteins, while the predominant TIM9-TIM10 70 kDa complex is crucial and mediates the import of much more proteins
SGD closest match:S000007348TIM8Mitochondrial import inner membrane translocase subunit TIM8
CGD closest match:CAL0000198973TIM8Mitochondrial import inner membrane translocase subunit TIM8

Protein alignments

%idAln lengthE-value
MIA_03295_178.41%883e-47MIA_03295_1
A0A060T452_BLAAD67.86%843e-38ARAD1A14278p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A14278g PE=3 SV=1
A0A1E3PM95_9ASCO65.88%855e-37Mitochondrial import inner membrane translocase subunit TIM8 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82340 PE=3 SV=1
UniRef50_A0A061AQW966.25%804e-31CYFA0S04e01486g1_1 n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A061AQW9_CYBFA
TIM8_YEAST62.64%913e-33Mitochondrial import inner membrane translocase subunit TIM8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM8 PE=1 SV=1
TIM8_CANAL61.11%903e-32Mitochondrial import inner membrane translocase subunit TIM8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM8 PE=3 SV=2
Q6C9F7_YARLI55.00%806e-29YALI0D11572p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D11572g PE=3 SV=2
A0A1E4TEN8_9ASCO50.59%852e-28Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_103059 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0468

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 93

Detailed signature matches

    1. PF02953 (zf-Tim10_DDP)
    2. SSF144122 (Tim10-like)

Protein sequence

>MCA_02522_1
MSSASTSIDSQALANLDTTTRKEIVDWIEAENSKSKVQMSIHNFTDMCFKKCITKVNSSTLDSQEESCLSNCLNRFLDTN
INIVKMIQQSQGH

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.