Protein

MCA_02310_1

Length
549 amino acids


Gene name: SWC4

Description: SWR1-complex protein 4

Browser: contigB:902883-904675+

RNA-seq: read pairs 1285, FPKM 28.9, percentile rank 51.7% (100% = highest expression)

Protein function

Annotation:SWC4SWR1-complex protein 4
KEGG:K11324DMAP1 DNA methyltransferase 1-associated protein 1
EGGNOG:0PK52SWC4Component of the SWR1 complex which mediates the ATP- dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair
SGD closest match:S000003234SWC4SWR1-complex protein 4
CGD closest match:CAL0000199374SWC4SWR1-complex protein 4

Protein alignments

%idAln lengthE-value
MIA_01151_162.96%3517e-128MIA_01151_1
A0A0J9XBV5_GEOCN53.72%3632e-99Similar to Saccharomyces cerevisiae YGR002C SWC4 Component of the Swr1p complex that incorporates Htz1p into chromatin OS=Geotrichum candidum GN=BN980_GECA08s04256g PE=4 SV=1
UniRef50_A0A0J9XBV553.72%3633e-96Similar to Saccharomyces cerevisiae YGR002C SWC4 Component of the Swr1p complex that incorporates Htz1p into chromatin n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBV5_GEOCN
A0A060TDI5_BLAAD42.19%3841e-69ARAD1D00594p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D00594g PE=4 SV=1
SWC4_YARLI43.01%3653e-68SWR1-complex protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWC4 PE=3 SV=1
A0A1E4TDI4_9ASCO38.62%3345e-52Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_58621 PE=4 SV=1
SWC4_YEAST37.50%3683e-48SWR1-complex protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWC4 PE=1 SV=1
A0A161HK67_9ASCO42.77%1592e-40Swc4p OS=Sugiyamaella lignohabitans GN=SWC4 PE=4 SV=1
A0A1E3PTS2_9ASCO37.79%2991e-35Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_68824 PE=4 SV=1
SWC4_CANAL36.41%2062e-18SWR1-complex protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWC4 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0850

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 450 500 549

Detailed signature matches

    1. PF16282 (SANT_DAMP1...)
    1. PF05499 (DMAP1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_02310_1
MASDFRDVLDIPERTQPAHPIKRHKSDAPVRRMEGMQRELYSLLGENTPPVAIFENRFKEKPSWNQKAVPWSWVPFTNAG
RKDGLTLHHWVRGRHTVDNEEYAFAKFNQKLSIPQFSKEDYENHLQDPEWTYEETCYLFDMCQDYDLRWIVIHDRYDFQQ
AVRDAHPDQKPSTPVKPEESLSTEDLPTESIKTAPITYSDPKIRTIEDLKARFYDVGRKVLKFRQARGEPSGPSQDVLYK
QMKYSKENEIIRKKHLEQLLARSPAEIAEEEALVLESRKLEAAAETLLLERAEVLKLLNAPSPTIKTAEYQTSQGLVQLT
NQLLSDKSRKRKDPSGATIPDSTSPSPATPSAAEAAAATSAPAKPQAQQETAAASATASGRKGEKAAAAAAPELKKSGSS
TKIKTEEEAASTSTASASNTKTKKGKREKEPTSSKKGHLTGSQAIAAAIHRKLSSKEEAAYGLSYHEKLNTGVYLRSSKI
TNYRPSQQAKIIQVLAELGIPSRPVMPTARVTSKFDSLQQSISVLLEAKKQADKLETEIKVLKAQKEMK

GO term prediction

Biological Process

GO:0045892 negative regulation of transcription, DNA-templated

Molecular Function

None predicted.

Cellular Component

GO:0005634 nucleus