Protein

MCA_02117_1

Length
398 amino acids

Gene name: PAN6

Description: Pantoate--beta-alanine ligase

Browser: contigB:282289-283785+

RNA-seq: read pairs 928, FPKM 28.7, percentile rank 51.5% (100% = highest expression)

Protein function

Annotation:PAN6Pantoate--beta-alanine ligase
KEGG:K01918panC pantoate--beta-alanine ligase [EC:6.3.2.1]
EGGNOG:0PHBRPAN6pantoate-beta-alanine ligase
SGD closest match:S000001407PAN6Pantoate--beta-alanine ligase
CGD closest match:CAL0000174427PAN6Pantoate--beta-alanine ligase

Protein alignments

%idAln lengthE-value
MIA_05470_165.09%3183e-147MIA_05470_1
A0A0J9XAG1_GEOCN57.59%3232e-130Similar to Saccharomyces cerevisiae YIL145C PAN6 Pantothenate synthase OS=Geotrichum candidum GN=BN980_GECA07s05235g PE=3 SV=1
A0A167FTK9_9ASCO57.76%3221e-126Pantoate--beta-alanine ligase PAN6 OS=Sugiyamaella lignohabitans GN=PAN6 PE=3 SV=1
UniRef50_A0A167FTK957.76%3224e-123Pantoate--beta-alanine ligase PAN6 n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A167FTK9_9ASCO
A0A060T1P9_BLAAD54.21%3214e-121ARAD1C22506p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C22506g PE=3 SV=1
Q6CFK9_YARLI52.29%3273e-112YALI0B06006p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B06006g PE=3 SV=1
A0A1E3PPJ1_9ASCO49.16%3587e-107Pantoate--beta-alanine ligase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40523 PE=3 SV=1
A0A1D8PS97_CANAL48.92%3252e-102Pantoate--beta-alanine ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAN6 PE=3 SV=1
A0A1E4TA57_9ASCO44.38%3385e-89Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_124325 PE=3 SV=1
PANC_YEAST46.67%3301e-86Pantoate--beta-alanine ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN6 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9972
Predicted cleavage: 36

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 398

Detailed signature matches

  1. Family IPR003721
    Pantoate-beta-alanine ligase
    1. MF_00158 (PanC)
    2. cd00560 (PanC)
    3. PF02569 (Pantoate_l...)
    4. TIGR00018
  2. Domain IPR014729
    Rossmann-like alpha/beta/alpha sandwich fold
    1. G3DSA:3.40.50...
  3. Domain IPR004821
    Cytidyltransferase-like domain
    1. TIGR00125
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.13...
  2. NON_CYTOPLASM... (N...)
  3. SIGNAL_PEPTIDE (Sig...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. SIGNAL_PEPTID... (S...)
  7. SSF52374 (Nucleotid...)
  8. mobidb-lite (disord...)

Residue annotation

  1. pantoate-binding s...
  2. ATP-binding site c...
  3. active site cd00560
  4. HXXH motif cd00560

Protein sequence

>MCA_02117_1
MISLRSLANSAFVASSSSLFVARILPTFTRQSIRKVSSVSPNNSSSLNFATSQINPNNTPSSSVNTNNTSQTKPNMTRIT
NINVLKTVQEVREWRRQIIMNNKTLGMVPTMGALHQGHLNLVKRSSEENDYTLISIFVNPSQFGPTEDLDAYPRTLETDI
EALSSVDTMNASINGLTVFAPSVQEMYPSGIPLEINKQRGAFVEVAGGLGQKLEGAIRPQFFRGVATIVTKLLNIATPDR
AYFGQKDIQQLIVVKRMVKDLLIGTEIVMVPTVREDNQLAMSSRNLYLTNESRSNSSILYHALAAGQQVYNQGEERRDVI
MKAIKNVLAPYDRSVVGSEAAKEGGFYIDVEYISLADKEELNELDTVRHGEGAVISAAIRVPNKSGTQTRIIDNILLD

GO term prediction

Biological Process

GO:0009058 biosynthetic process
GO:0015940 pantothenate biosynthetic process

Molecular Function

GO:0003824 catalytic activity
GO:0004592 pantoate-beta-alanine ligase activity

Cellular Component

None predicted.