Protein

MCA_02066_1

Length
414 amino acids


Gene name: SEN2

Description: tRNA-splicing endonuclease subunit SEN2

Browser: contigB:137623-138868+

RNA-seq: read pairs 1701, FPKM 50.6, percentile rank 65.6% (100% = highest expression)

Protein function

Annotation:SEN2tRNA-splicing endonuclease subunit SEN2
KEGG:K15322TSEN2 tRNA-splicing endonuclease subunit Sen2 [EC:3.1.27.9]
EGGNOG:0PJUTSEN2Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. This subunit may anchor the endonuclease complex to the nuclear membrane. Probably carries the active site for 5'-splice site cleavage
SGD closest match:S000004095SEN2tRNA-splicing endonuclease subunit SEN2
CGD closest match:CAL0000185355SEN2tRNA-splicing endonuclease subunit Sen2

Protein alignments

%idAln lengthE-value
MIA_05523_147.11%3801e-76MIA_05523_1
A0A0J9XER8_GEOCN44.32%3618e-77tRNA-splicing endonuclease subunit Sen2 OS=Geotrichum candidum GN=BN980_GECA12s02430g PE=3 SV=1
UniRef50_A0A0J9XER844.32%3612e-73tRNA-splicing endonuclease subunit Sen2 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XER8_GEOCN
A0A167C3K9_9ASCO34.38%4134e-53tRNA-splicing endonuclease subunit Sen2 OS=Sugiyamaella lignohabitans GN=SEN2 PE=3 SV=1
Q5AF73_CANAL33.88%3668e-52tRNA-splicing endonuclease subunit Sen2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEN2 PE=3 SV=1
Q6CFG1_YARLI38.79%3481e-51tRNA-splicing endonuclease subunit Sen2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B07293g PE=3 SV=1
SEN2_YEAST34.96%3691e-49tRNA-splicing endonuclease subunit SEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN2 PE=1 SV=1
A0A060T1W9_BLAAD37.53%3652e-49tRNA-splicing endonuclease subunit Sen2 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C19866g PE=3 SV=1
A0A1E3PRH4_9ASCO43.37%1961e-40tRNA-splicing endonuclease subunit Sen2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81026 PE=3 SV=1
A0A1E4TA26_9ASCO34.42%1541e-23Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_19218 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4074

Protein family membership

Domains and repeats

1 50 100 150 200 250 300 350 414

Detailed signature matches

    1. PIRSF011789 (tRNA_e...)
    1. PF01974 (tRNA_int_endo)
    2. SSF53032 (tRNA-intr...)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_02066_1
METWLDSIYRNVDYILKVPYGALFPSTYKQSGSSNNDNSTANKKRVKNSYKSKYRDLPAQFRPFPAFQYNNPISWGLVFL
EYVWPTPLEPLTTKCVADLTGVGRLTVVRVDDRDQQMYLWEHGFFGKGVYSRSEPSWYPRNVRRLGLPEASTIPLTSEER
TFYRRQERLKFKQERARLEEERLELIRRQEQGEDVEILNILEQKEAERPVRFDNVDLEIFKAKYWRPEDADLIVMGRSSL
PSIEYVQLMPYEAIFLSEFMHCLDVRSTGGVVLKGWSLVEALTAGRPLHEFLAYYAAYHHYRSKGWCVRSGVKFSTDFIL
YNRGPVFTHAEFAVMVVPVCDESSLETNLWFEQTLKSRIIGGVKKTMIQCFVQTPSKELLESIDFEKVSIRQVLQDYFYI
TDISTTRWIPSKNR

GO term prediction

Biological Process

GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation

Molecular Function

GO:0000213 tRNA-intron endonuclease activity

Cellular Component

GO:0000214 tRNA-intron endonuclease complex