Protein
MCA_02066_1
Length
414 amino acids
Gene name: SEN2
Description: tRNA-splicing endonuclease subunit SEN2
Browser: contigB:137623-138868+
RNA-seq: read pairs 1701, FPKM 50.6, percentile rank 65.6% (100% = highest expression)
Protein function
| Annotation: | SEN2 | tRNA-splicing endonuclease subunit SEN2 | |
|---|---|---|---|
| KEGG: | K15322 | TSEN2 | tRNA-splicing endonuclease subunit Sen2 [EC:3.1.27.9] |
| EGGNOG: | 0PJUT | SEN2 | Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. This subunit may anchor the endonuclease complex to the nuclear membrane. Probably carries the active site for 5'-splice site cleavage |
| SGD closest match: | S000004095 | SEN2 | tRNA-splicing endonuclease subunit SEN2 |
| CGD closest match: | CAL0000185355 | SEN2 | tRNA-splicing endonuclease subunit Sen2 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05523_1 | 47.11% | 380 | 1e-76 | MIA_05523_1 |
| A0A0J9XER8_GEOCN | 44.32% | 361 | 8e-77 | tRNA-splicing endonuclease subunit Sen2 OS=Geotrichum candidum GN=BN980_GECA12s02430g PE=3 SV=1 |
| UniRef50_A0A0J9XER8 | 44.32% | 361 | 2e-73 | tRNA-splicing endonuclease subunit Sen2 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XER8_GEOCN |
| A0A167C3K9_9ASCO | 34.38% | 413 | 4e-53 | tRNA-splicing endonuclease subunit Sen2 OS=Sugiyamaella lignohabitans GN=SEN2 PE=3 SV=1 |
| Q5AF73_CANAL | 33.88% | 366 | 8e-52 | tRNA-splicing endonuclease subunit Sen2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEN2 PE=3 SV=1 |
| Q6CFG1_YARLI | 38.79% | 348 | 1e-51 | tRNA-splicing endonuclease subunit Sen2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B07293g PE=3 SV=1 |
| SEN2_YEAST | 34.96% | 369 | 1e-49 | tRNA-splicing endonuclease subunit SEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN2 PE=1 SV=1 |
| A0A060T1W9_BLAAD | 37.53% | 365 | 2e-49 | tRNA-splicing endonuclease subunit Sen2 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C19866g PE=3 SV=1 |
| A0A1E3PRH4_9ASCO | 43.37% | 196 | 1e-40 | tRNA-splicing endonuclease subunit Sen2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81026 PE=3 SV=1 |
| A0A1E4TA26_9ASCO | 34.42% | 154 | 1e-23 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_19218 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4074
Protein family membership
- tRNA-splicing endonuclease (IPR006676)
- tRNA-splicing endonuclease, SEN2 subunit (IPR016589)
Domains and repeats
-
Domain
1
50
100
150
200
250
300
350
414
Detailed signature matches
-
-
PIRSF011789 (tRNA_e...)
-
no IPR
Unintegrated signatures
Protein sequence
>MCA_02066_1 METWLDSIYRNVDYILKVPYGALFPSTYKQSGSSNNDNSTANKKRVKNSYKSKYRDLPAQFRPFPAFQYNNPISWGLVFL EYVWPTPLEPLTTKCVADLTGVGRLTVVRVDDRDQQMYLWEHGFFGKGVYSRSEPSWYPRNVRRLGLPEASTIPLTSEER TFYRRQERLKFKQERARLEEERLELIRRQEQGEDVEILNILEQKEAERPVRFDNVDLEIFKAKYWRPEDADLIVMGRSSL PSIEYVQLMPYEAIFLSEFMHCLDVRSTGGVVLKGWSLVEALTAGRPLHEFLAYYAAYHHYRSKGWCVRSGVKFSTDFIL YNRGPVFTHAEFAVMVVPVCDESSLETNLWFEQTLKSRIIGGVKKTMIQCFVQTPSKELLESIDFEKVSIRQVLQDYFYI TDISTTRWIPSKNR
GO term prediction
Biological Process
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation
Molecular Function
GO:0000213 tRNA-intron endonuclease activity
Cellular Component
GO:0000214 tRNA-intron endonuclease complex