Protein

MCA_02017_1

Length
395 amino acids

Gene name: SIL1

Description: Nucleotide exchange factor SIL1

Browser: contigB:37159-38422-

RNA-seq: read pairs 1402, FPKM 43.7, percentile rank 62.4% (100% = highest expression)

Protein function

Annotation:SIL1Nucleotide exchange factor SIL1
EGGNOG:0QD6TSIL1Required for protein translocation and folding in the endoplasmic reticulum (ER). Functions as a nucleotide exchange factor for the ER lumenal chaperone KAR2
SGD closest match:S000005391SIL1Nucleotide exchange factor SIL1
CGD closest match:CAL0000176393SIL1Nucleotide exchange factor SIL1

Protein alignments

%idAln lengthE-value
MIA_05610_127.31%2603e-21MIA_05610_1
A0A0J9X5I4_GEOCN25.27%2734e-16Similar to Saccharomyces cerevisiae YOL031C SIL1 Nucleotide exchange factor for the endoplasmic reticulum (ER) lumenal Hsp70 chaperone Kar2p, required for protein translocation into the ER OS=Geotrichum candidum GN=BN980_GECA03s02419g PE=4 SV=1
UniRef50_A0A0J9X5I425.27%2739e-13Similar to Saccharomyces cerevisiae YOL031C SIL1 Nucleotide exchange factor for the endoplasmic reticulum (ER) lumenal Hsp70 chaperone Kar2p, required for protein translocation into the ER n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5I4_GEOCN
A0A167FXF4_9ASCO22.18%2935e-10Sil1p OS=Sugiyamaella lignohabitans GN=SIL1 PE=4 SV=1
SIL1_CANAL26.92%2603e-07Nucleotide exchange factor SIL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIL1 PE=3 SV=1
SIL1_YEAST25.37%1341e-05Nucleotide exchange factor SIL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIL1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1346
Predicted cleavage: 22

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 395

Detailed signature matches

  1. Family IPR031884
    Nucleotide exchange factor Sil1, fungi
    1. PF16782 (SIL1)
  2. Domain IPR016024
    Armadillo-type fold
    1. SSF48371 (ARM repeat)
  3. Domain IPR011989
    Armadillo-like helical
    1. G3DSA:1.25.10.10
Unintegrated signatures no IPR
Unintegrated signatures
  1. NON_CYTOPLASM... (N...)
  2. SIGNAL_PEPTIDE (Sig...)
  3. SIGNAL_PEPTID... (S...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)

Protein sequence

>MCA_02017_1
MNTSHISLTSKQETAYKSPRQTVSTLKMNLLLILLYLFNIRSFIGFSHASEVDSKHVEGSDTTKAKIQTVEPGFHVKIDL
GGRKNENIDSHSDSVEKGLLFVENSDEKNLNNYDDGNEEVKEVENERRDYYRYAASSEGPYLRSLLEKLKKYESLPEQEQ
LETLENIGDLAHDILHGVTVAKDGVDALMGIAVSEKSSKKAKELSIISLGATFNNNEEAILVSEGKSLVKKLLQLLAKVN
DDTIRRRIVYAISSIESQSKNYQKEFLANDGSKLYLSIFENSDDMLKKRILQVVSTKTSTDWPLKEIQNWSNMLQNNIIH
EPPATYKWILFSVLTRLHEHNELNVDEHFLDWISKEAEALKQTRAEGEEQNYREEVLKARHLVFGNPKAARKDEL

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0000774 adenyl-nucleotide exchange factor activity
GO:0005488 binding

Cellular Component

GO:0005783 endoplasmic reticulum