Protein

MCA_01906_1

Length
1,008 amino acids

Gene name: SPT16

Description: FACT complex subunit SPT16

Browser: contigA:5837210-5840363+

RNA-seq: read pairs 3848, FPKM 47.1, percentile rank 64.0% (100% = highest expression)

Protein function

Annotation:SPT16FACT complex subunit SPT16
EGGNOG:0PGE8SPT16Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II
SGD closest match:S000003175SPT16FACT complex subunit SPT16
CGD closest match:CAL0000198046CDC68FACT complex subunit SPT16

Protein alignments

%idAln lengthE-value
MIA_02263_174.08%9220.0MIA_02263_1
A0A0J9X9F6_GEOCN67.71%9230.0Similar to Saccharomyces cerevisiae YGL207W SPT16 Subunit of the heterodimeric FACT complex, which associates with chromatin via interaction with Nhp6Ap and Nhp6Bp OS=Geotrichum candidum GN=BN980_GECA05s01676g PE=4 SV=1
A0A1E3PEE3_9ASCO56.42%9500.0SPT16-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_72043 PE=4 SV=1
A0A060T472_BLAAD56.58%9350.0ARAD1B00792p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B00792g PE=4 SV=1
A0A1E4TG07_9ASCO54.75%9260.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_109297 PE=4 SV=1
UniRef50_A0A1E4TG0754.75%9260.0Uncharacterized protein n=1 Tax=Tortispora caseinolytica NRRL Y-17796 TaxID=767744 RepID=A0A1E4TG07_9ASCO
A0A161HNK7_9ASCO63.08%7720.0Chromatin-remodeling protein SPT16 OS=Sugiyamaella lignohabitans GN=SPT16 PE=4 SV=1
SPT16_YARLI53.04%9370.0FACT complex subunit SPT16 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPT16 PE=3 SV=1
SPT16_CANAL47.20%9830.0FACT complex subunit SPT16 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC68 PE=3 SV=2
SPT16_YEAST46.99%9640.0FACT complex subunit SPT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT16 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0606

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 100 200 300 400 500 600 700 800 900 1008

Detailed signature matches

  1. Domain IPR029149
    Creatinase/Aminopeptidase P/Spt16, N-terminal
    1. G3DSA:3.40.35...
  2. Domain IPR029148
    FACT complex subunit Spt16, N-terminal lobe domain
    1. SM01285 (FACT_Spt16...)
    2. PF14826 (FACT-Spt16...)
  3. Domain IPR000994
    Peptidase M24
    1. SSF55920 (Creatinas...)
    2. PF00557 (Peptidase_M24)
  4. Domain IPR033825
    FACT complex subunit SPT16
    1. cd01091 (CDC68-like)
  5. Domain IPR013953
    FACT complex subunit Spt16p/Cdc68p
    1. SM01286 (SPT16_2)
    2. PF08644 (SPT16)
  6. Domain IPR013719
    Domain of unknown function DUF1747
    1. PF08512 (Rtt106)
    2. SM01287 (Rtt106_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.90.23...
  3. mobidb-lite (disord...)

Residue annotation

  1. active site cd01091

Protein sequence

>MCA_01906_1
MSDIKIDAGVFSKRIRAFQKAIATKKPILNGASSILIIIGKPDEDYRKSSVVHTWLLGYEFPTTALLITKDESIFITSTS
KAKHLAAIKGSSVLVWTRNPKDAEHNKKLFVDLINKMTEAGPNVGVIPKDEYQGPFINEWKEVYKPSEQNLTEVDISRAI
SELLYIKDEDEIQSIRIASKASTGVMSKFLADEISTIIDEERKVKHSDLSETVNNKIDDNKFFQKVLKLGDSIDPMQLDW
CYSPVIESGGNFDLRPSAIADDNTLYGGVIVTFLGLRYKSYCSNIGRTYLIDPTKAQESNYTFAVSLENKVLESIKEGTK
IKDVYIAAQEFIKEKKPELLPYFLKNVGWGTGIEFRDNTLLLNEKNPHVLKEGMTLNVVIGFQNIPNDDATDTKSKVYSI
LLIDTIKVTNGHPIVFTESPKSRGDVSYYFKEEEEDSKPVKKEVKKPTKTAILKTKLRGETKSQDEDPEIKRRLNQKELH
EQLQKAGLEKYADEKSGDKNVSKTSMKRYESYKHASQLPKNTKDLRILIDSKNRTILLPINGRMVPIHISYYKNGSKNEE
GDFVYLRLNFNSPGQGVSKKEDVPFGDADSQFVRSITFRSRDGARMAEILKRITDMKKDAVKLEAEKKEMADVIEQGKLI
QVKNHRPIRLDSIFIRPPPEGKRVAGLVEIHQNGLRYQSPIRSDLNLDILFSNIKHLFFQPCDHEMIVIIHAHLKNPIMV
GKKKTKDIQIYREATDLAYDETGNSRRRKYRYGDEDELEQEQMERQRRIALNKEFKKFAEEISNATKNVLEVEIPFRDLG
FNGVPFRSDVLCQPTTECLIQLIDPPFLVVTLSEIEVVNLERVQFGLRQFDMVIVYKDYSKPVTHINSIPMTQLDSVKDW
LNSMDIPYYEGPVNLNWPTIMKTVQNDPHEFFASKGWSFLGTESDGSGGEESEESEEESEFQASDEEPEDESDSYSEDGS
DFSDESEASSGEFDDESGEDWDELDNKAMKQDIKASRVKAEETKKRKR

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.