Protein

MCA_01903_1

Length
170 amino acids


Browser: contigA:5832785-5833546-

RNA-seq: read pairs 1313, FPKM 94.9, percentile rank 77.7% (100% = highest expression)

Protein function

KEGG:K11086SNRPB small nuclear ribonucleoprotein B and B'
EGGNOG:0PPADFG01082.1Small nuclear ribonucleoprotein
SGD closest match:S000000831SMB1Small nuclear ribonucleoprotein-associated protein B
CGD closest match:CAL0000198927CAALFM_CR07510WAmRNA splicing protein

Protein alignments

%idAln lengthE-value
Q6C948_YARLI54.33%1275e-36YALI0D14102p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D14102g PE=4 SV=1
A0A0J9XDI1_GEOCN58.33%967e-32Similar to Saccharomyces cerevisiae YER029C SMB1 Core Sm protein Sm B OS=Geotrichum candidum GN=BN980_GECA10s03244g PE=4 SV=1
A0A060T4N2_BLAAD54.90%1024e-31ARAD1B00858p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B00858g PE=4 SV=1
MIA_02266_167.01%973e-30MIA_02266_1
UniRef50_A0A1E4TPL852.34%1071e-26Uncharacterized protein n=1 Tax=Pachysolen tannophilus NRRL Y-2460 TaxID=669874 RepID=A0A1E4TPL8_PACTA
A0A1E3PR15_9ASCO42.86%1401e-26LSM-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40538 PE=4 SV=1
A0A1D8PTI0_CANAL38.61%1015e-19mRNA splicing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR07510WA PE=4 SV=1
RSMB_YEAST45.65%929e-15Small nuclear ribonucleoprotein-associated protein B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMB1 PE=1 SV=1
A0A161HHX5_9ASCO49.32%732e-14Sm snRNP core protein Smb1 OS=Sugiyamaella lignohabitans GN=smb1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0147

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 170

Detailed signature matches

    1. SSF50182 (Sm-like r...)
    1. PF01423 (LSM)
    2. SM00651 (Sm3)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd01717 (Sm_B)
  2. mobidb-lite (disord...)

Residue annotation

  1. heptamer interface...
  2. Sm1 motif cd01717
  3. putative hexamer i...
  4. RNA binding site c...
  5. Sm2 motif cd01717

Protein sequence

>MCA_01903_1
MVVADLVHYRLRVVLLDGRQLIGELLAFDKYMNIVLADTEEFRATRKSLVAAKKAASSGDSSTNIPPIRETKRALGLIIL
RGETIISVSVEAPPRTVDPAARLGGIVSSSDPSNAGVVAQGQGFAKPINRAPSATLAAPARTSAASFFGGGSAGSGVPPG
FQPPPGFGGR

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.