Protein

MCA_01784_1

Length
51 amino acids

Description: protein with ribonuclease H domain

Browser: contigA:5445354-5445510+

RNA-seq: read pairs 10, FPKM 2.4, percentile rank 12.5% (100% = highest expression)

Protein function

Annotation:protein with ribonuclease H domain

Protein alignments

%idAln lengthE-value
MIA_01558_152.78%361e-05MIA_01558_1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0457

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 5 10 15 20 25 30 35 40 45 51

Detailed signature matches

  1. Domain IPR012337
    Ribonuclease H-like domain
    1. G3DSA:3.30.42...
  2. Domain IPR002156
    Ribonuclease H domain
    1. PS50879 (RNASE_H)

Protein sequence

>MCA_01784_1
MDCRSTYNKLFNMGTRIEFEYVEGHSGDYGNEEGNRLAILGARNIYYNRVH

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

Cellular Component

None predicted.