Protein
MCA_01770_1
Length
222 amino acids
Gene name: ERD2
Description: ER lumen protein-retaining receptor
Browser: contigA:5415983-5416762-
RNA-seq: read pairs 1390, FPKM 77.0, percentile rank 74.6% (100% = highest expression)
Protein function
| Annotation: | ERD2 | ER lumen protein-retaining receptor | |
|---|---|---|---|
| KEGG: | K10949 | KDELR | ER lumen protein retaining receptor |
| EGGNOG: | 0PKGJ | ERD2 | Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi (By similarity) |
| SGD closest match: | S000000136 | ERD2 | ER lumen protein-retaining receptor |
| CGD closest match: | CAL0000188440 | orf19.2756 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00711_1 | 71.62% | 222 | 3e-107 | MIA_00711_1 |
| A0A0J9X5A7_GEOCN | 65.77% | 222 | 2e-103 | ER lumen protein-retaining receptor OS=Geotrichum candidum GN=BN980_GECA03s01088g PE=3 SV=1 |
| A0A1E4TJ94_9ASCO | 59.91% | 222 | 7e-91 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_76607 PE=4 SV=1 |
| A0A1E3PT81_9ASCO | 58.11% | 222 | 2e-88 | ER lumen protein-retaining receptor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81519 PE=3 SV=1 |
| UniRef50_A0A0L0RZ33 | 55.41% | 222 | 2e-83 | ER lumen protein-retaining receptor n=4 Tax=Fungi TaxID=4751 RepID=A0A0L0RZ33_ALLMA |
| A0A060T7C3_BLAAD | 60.18% | 221 | 6e-86 | ER lumen protein-retaining receptor OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C20372g PE=3 SV=1 |
| Q6CA22_YARLI | 54.67% | 225 | 4e-84 | YALI0D06545p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D06545g PE=4 SV=1 |
| Q5AF52_CANAL | 53.85% | 221 | 9e-83 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2756 PE=4 SV=1 |
| ERD2_YEAST | 47.79% | 226 | 8e-71 | ER lumen protein-retaining receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERD2 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7474
Protein family membership
- ER lumen protein retaining receptor (IPR000133)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_01770_1 MNIFRLAADFSHVLSIILLLHKIHTSKSAAGISFKTQALYALVFVTRYIDLFIHYISLYNTILKIVFLTTSFYTLYLMEK RNAKNRGSADSVATNTTIDTFRVEYLIGGSLILALCFPSDGKYDIVNVAWTFSLWLESVAILPQLFMLQRTGEAESLTVH YIFALGVYRGFYVLNWVYRYWSTGWFDMTSFITGIIQTALYSDFFYVYYTRVMKGKKFELPQ
GO term prediction
Biological Process
GO:0006621 protein retention in ER lumen
Molecular Function
GO:0046923 ER retention sequence binding
Cellular Component
GO:0016021 integral component of membrane