Protein

MCA_01601_1

Length
399 amino acids

Gene name: YHB1

Description: Flavohemoprotein; Nitric oxide oxidoreductase

Browser: contigA:4942971-4944171+

RNA-seq: read pairs 5470, FPKM 169.0, percentile rank 86.2% (100% = highest expression)

Protein function

Annotation:YHB1Flavohemoprotein; Nitric oxide oxidoreductase
KEGG:K05916hmp nitric oxide dioxygenase [EC:1.14.12.17]
EGGNOG:0PJPTFG04458.1K05916 nitric oxide dioxygenase EC 1.14.12.17
SGD closest match:S000003466YHB1Flavohemoprotein
CGD closest match:CAL0000179202YHB1Flavohemoprotein

Protein alignments

%idAln lengthE-value
MIA_02690_155.85%4103e-149MIA_02690_1
A0A0J9XEW3_GEOCN52.33%4078e-147Similar to Saccharomyces cerevisiae YGR234W YHB1 Nitric oxide oxidoreductase OS=Geotrichum candidum GN=BN980_GECA12s03167g PE=3 SV=1
UniRef50_A0A0J9XEW352.33%4072e-143Similar to Saccharomyces cerevisiae YGR234W YHB1 Nitric oxide oxidoreductase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XEW3_GEOCN
A0A060T0W4_BLAAD37.62%4041e-87ARAD1C11660p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11660g PE=3 SV=1
FHP_CANAL38.94%3985e-84Flavohemoprotein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YHB1 PE=2 SV=1
A0A1E3PJ88_9ASCO37.22%4035e-83Nitric oxide dioxygenase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83447 PE=3 SV=1
Q6CB74_YARLI38.29%3973e-74YALI0C21362p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C21362g PE=3 SV=1
A0A167EK10_9ASCO35.06%4056e-74Yhb1p OS=Sugiyamaella lignohabitans GN=YHB1 PE=3 SV=1
FHP_YEAST33.66%4074e-56Flavohemoprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHB1 PE=1 SV=2
A0A1E4TC39_9ASCO27.54%1388e-06Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_14593 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1879
Predicted cleavage: 66

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 399

Detailed signature matches

  1. Family IPR000951
    Phthalate dioxygenase reductase
    1. PR00409 (PHDIOXRDTASE)
  2. Domain IPR009050
    Globin-like
    1. SSF46458 (Globin-like)
  3. Domain IPR000971
    Globin
    1. PF00042 (Globin)
    2. PS01033 (GLOBIN)
  4. Domain IPR017938
    Riboflavin synthase-like beta-barrel
    1. SSF63380 (Riboflavi...)
  5. Domain IPR017927
    Ferredoxin reductase-type FAD-binding domain
    1. PS51384 (FAD_FR)
  6. Domain IPR008333
    Oxidoreductase, FAD-binding domain
    1. PF00970 (FAD_binding_6)
  7. Domain IPR001433
    Oxidoreductase FAD/NAD(P)-binding
    1. PF00175 (NAD_binding_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.49...
  2. G3DSA:2.40.30.10
  3. G3DSA:3.40.50.80
  4. SSF52343 (Ferredoxi...)
  5. cd06184 (flavohem_l...)
  6. cd08922 (FHb-globin)

Residue annotation

  1. heme binding site ...
  2. NAD- and FAD-bindi...
  3. FAD binding site c...
  4. FAD binding pocket...
  5. FAD binding motif ...
  6. phosphate binding ...
  7. beta-alpha-beta st...
  8. NAD binding pocket...
  9. Heme binding pock...

Protein sequence

>MCA_01601_1
MPLTPAQVQTIKATIPILKEGGVALTTKFYQNMFHNNPEVLPYFNQAHQKSGAQPRALAHAVLMYATYIDDLSKLGDLVN
RITAKHVVLDVPASGYPIVGQNLIATIKEVLGPEIANEQVIDAWTAAYGDLANLLIDIEEKMYQAGEWRGYRPFVVKGKV
LESPDVVSVYVTPADGKGIKKLGKPGQYIGIKVDDAEAFKESGGSTRREYTLTGQDSDHFRISVKRIPDGVFSNYVHDKL
QVGQNVEIAPPQGDFVVEDAAQVKKAVFLCGGIGVTPVLSLAKQLVNAGTDVTIAYSVHSHKELPFTKEFDELRNASAKI
VHYFTKEDGSNSSLPAQSKAGKRIEFEDVKELTQDEDSHVFYLGPMSFMADVSKYLQDLSIPQERIHREFFLPDQSIVC

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0016491 oxidoreductase activity
GO:0020037 heme binding

Cellular Component

None predicted.