Protein

MCA_01584_1

Length
723 amino acids

Gene name: DBP9

Description: ATP-dependent RNA helicase DBP9

Browser: contigA:4893443-4895615-

RNA-seq: read pairs 1395, FPKM 23.8, percentile rank 46.2% (100% = highest expression)

Protein function

Annotation:DBP9ATP-dependent RNA helicase DBP9
KEGG:K14810DDX56 ATP-dependent RNA helicase DDX56/DBP9 [EC:3.6.4.13]
EGGNOG:0PFWADBP9ATP-binding RNA helicase involved in the biogenesis of 60S ribosomal subunits and is required for the normal formation of 25S and 5.8S rRNAs (By similarity)
SGD closest match:S000004266DBP9ATP-dependent RNA helicase DBP9
CGD closest match:CAL0000180288DBP9ATP-dependent RNA helicase DBP9

Protein alignments

%idAln lengthE-value
MIA_03098_165.05%6610.0MIA_03098_1
A0A0J9XAV6_GEOCN57.82%6330.0Similar to Saccharomyces cerevisiae YLR276C DBP9 ATP-dependent RNA helicase of the DEAD-box family involved in biogenesis of the 60S ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA07s02716g PE=4 SV=1
A0A161HKA2_9ASCO53.37%5940.0Dbp9p OS=Sugiyamaella lignohabitans GN=DBP9 PE=4 SV=1
A0A060TBG4_BLAAD52.18%5960.0ARAD1D27676p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D27676g PE=4 SV=1
A0A1E3PQF4_9ASCO49.85%6560.0DEAD-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45621 PE=4 SV=1
UniRef50_Q6BLM547.93%6280.0ATP-dependent RNA helicase DBP9 n=28 Tax=saccharomyceta TaxID=716545 RepID=DBP9_DEBHA
DBP9_YEAST49.14%6410.0ATP-dependent RNA helicase DBP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP9 PE=1 SV=1
DBP9_CANAL50.00%5840.0ATP-dependent RNA helicase DBP9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP9 PE=3 SV=2
DBP9_YARLI49.39%5719e-173ATP-dependent RNA helicase DBP9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP9 PE=3 SV=1
A0A1E4TKN2_9ASCO43.71%6367e-160Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_84541 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1766

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 100 200 300 400 500 600 723

Detailed signature matches

  1. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  2. Domain IPR014014
    RNA helicase, DEAD-box type, Q motif
    1. PS51195 (Q_MOTIF)
  3. Domain IPR014001
    Helicase superfamily 1/2, ATP-binding domain
    1. PS51192 (HELICASE_A...)
    2. SM00487 (ultradead3)
  4. Domain IPR011545
    DEAD/DEAH box helicase domain
    1. PF00270 (DEAD)
  5. Domain IPR001650
    Helicase, C-terminal
    1. PS51194 (HELICASE_CTER)
    2. SM00490 (helicmild6)
    3. PF00271 (Helicase_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.40.50...
  3. cd00079 (HELICc)
  4. mobidb-lite (disord...)

Residue annotation

  1. nucleotide binding...
  2. ATP-binding site c...

Protein sequence

>MCA_01584_1
MGSSKNKVSVKDRVSKSLKKSKKTDKKEKPIEKQEEKIEEQELSETEESKEKEQTSSDEESEEEKEEVQEENEQQKDDSH
ENYTSEEQRLLSVDEEMLEDTNFDGLDLDSRLVQALTLMKLYKPTSIQAKAIPLALGLKKDIIGRAKTGSGKTVAYAIPI
VESILQESVQKLGSNNTGSSSSYIGNRAIILVPSRELANQVTKLFESLSIFADKIVGVVNVSQQASGSAGGAKGDVIIDS
ILATTKPAIIVGTPARVVSHLQSGSIDCSAISYLVIDEADLINSYGFQEDLDTLASLLPVKKTIQTWLMSATLSEEINEM
KEKFCRKNLATLKLEDDGKDNSQNNQNNKLLQYYAKCSEIDKFLLAYVIFKLNLIRGKTLIFVNTTERCYQLKLFFEQFG
IKSTVLNSELPVASRLHIVDEFNRDVYNLLIATDENTHYTKADEQEEEEAAENDKGEENSEKSKESSKGKKKFKKDQEYS
VSRGVDFKNVSCVLNFDFPTSSTTYTHRVGRTARADKSGMSLSFVVPRKEYKKHRSCSVETTKRDEKILSRIISHQEKKI
RKIQALNEDGPSITELSSDPSMMIQPYIFDMKQVEAFRYRMEDAFRAVTKIAVREARLKEIKSELLASEKLKRHFEENPE
DLVQLRHDKELHSATVQPHMKRIPQYLIPTAARKSLTPIGGPGMATYAGIKKPQSNRQKKFQKKMNNNRRKSGGKNPLKT
FGK

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding
GO:0005524 ATP binding

Cellular Component

None predicted.