Protein

MCA_01505_1

Length
383 amino acids

Gene name: URE2

Description: Transcriptional regulator URE2

Browser: contigA:4660567-4662256+

RNA-seq: read pairs 2437, FPKM 78.4, percentile rank 74.9% (100% = highest expression)

Protein function

Annotation:URE2Transcriptional regulator URE2
KEGG:K00799GST glutathione S-transferase [EC:2.5.1.18]
EGGNOG:0PHHEURE2glutathione s-transferase
SGD closest match:S000005173URE2Transcriptional regulator URE2
CGD closest match:CAL0000198677URE2Protein URE2

Protein alignments

%idAln lengthE-value
MIA_02727_180.66%2749e-166MIA_02727_1
A0A060SYG7_BLAAD75.49%2535e-148Protein URE2 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A12210g PE=3 SV=1
A0A0J9X904_GEOCN75.78%2564e-145Protein URE2 OS=Geotrichum candidum GN=BN980_GECA05s04619g PE=3 SV=1
A0A167E427_9ASCO75.10%2531e-144Protein URE2 OS=Sugiyamaella lignohabitans GN=URE2 PE=3 SV=1
Q6CD77_YARLI72.31%2604e-142Protein URE2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C03069g PE=3 SV=1
A0A1E3PHZ9_9ASCO66.40%2502e-125Glutathione S-transferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83111 PE=3 SV=1
UniRef50_A0A0J9XBH765.07%2724e-124Protein URE2 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBH7_GEOCN
URE2_CANAL61.66%2539e-114Protein URE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URE2 PE=3 SV=1
URE2_YEAST58.50%2531e-107Transcriptional regulator URE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URE2 PE=1 SV=1
A0A1E4TKK6_9ASCO54.77%2419e-96Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_18585 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3493

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 383

Detailed signature matches

  1. Family IPR017298
    Transcriptional regulator Ure2
    1. PIRSF037861 (Prion_...)
  2. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
  3. Domain IPR004045
    Glutathione S-transferase, N-terminal
    1. PF02798 (GST_N)
    2. PS50404 (GST_NTER)
  4. Domain IPR010987
    Glutathione S-transferase, C-terminal-like
    1. SSF47616 (GST C-ter...)
    2. PS50405 (GST_CTER)
  5. Domain IPR004046
    Glutathione S-transferase, C-terminal
    1. PF00043 (GST_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.20.10...
  2. G3DSA:3.40.30.10
  3. cd03048 (GST_N_Ure2...)
  4. mobidb-lite (disord...)

Residue annotation

  1. C-terminal domain ...
  2. GSH binding site (...
  3. dimer interface cd...

Protein sequence

>MCA_01505_1
MGVQNGKKPVSNLSSALANIHLSNSGSSPNSQYSQQPQNEDLIQNQQRFGFNANNNNNNSQHQINNINTDQNLNRNHNFN
DCDPRFINSGNIQNQNLHNPQQQNQENATRAPYYIPSADVNMSQVPEDFPLDRIGLYRKNLPTEGISLFSHRSAPNGFKI
AVILSELGIKYKTFYMDFKRNEQRSPYFLPLNPNARVPAIIDHDNDDLAVWESGAIIMYLCQRAGQGCPLWADDISEQAQ
ITSWLFFQASGHAPMIGQALHFRYFHPERIPSAMIRYENEVRRTYGVVEMRLAELREQLIYEMEEDQSFSLGTSALSESK
YFKDPIWLVGNRMTVADLTFVTWNHVVDRIGIDLKNEFPEVYKWTQAMLSRPLVKRALNGLES

GO term prediction

Biological Process

GO:0006808 regulation of nitrogen utilization

Molecular Function

GO:0003714 transcription corepressor activity
GO:0005515 protein binding

Cellular Component

None predicted.