Protein

MCA_01420_1

Length
368 amino acids

Browser: contigA:4414882-4416048-

RNA-seq: read pairs 2271, FPKM 76.0, percentile rank 74.4% (100% = highest expression)

Protein function

KEGG:K05610UCHL5 ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
EGGNOG:0PIV9PGUG_03064ubiquitin carboxyl-terminal hydrolase
CGD closest match:CAL0000184421YUH2Ubiquitin carboxyl-terminal hydrolase

Protein alignments

%idAln lengthE-value
A0A0J9X592_GEOCN52.53%3569e-119Ubiquitin carboxyl-terminal hydrolase OS=Geotrichum candidum GN=BN980_GECA02s03211g PE=3 SV=1
UniRef50_A0A0J9X59252.53%3562e-115Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X592_GEOCN
MIA_02776_154.06%3575e-116MIA_02776_1
A0A060T833_BLAAD49.42%3442e-92Ubiquitin carboxyl-terminal hydrolase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C33198g PE=3 SV=1
Q6CEC7_YARLI40.55%3651e-80Ubiquitin carboxyl-terminal hydrolase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B16698g PE=3 SV=1
A0A1D8PNY8_CANAL41.46%3573e-74Ubiquitin carboxyl-terminal hydrolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YUH2 PE=3 SV=1
A0A1E3PRI8_9ASCO40.00%3902e-71Ubiquitin carboxyl-terminal hydrolase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44711 PE=3 SV=1
A0A1E4TK82_9ASCO39.11%3585e-68Ubiquitin carboxyl-terminal hydrolase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_82019 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0219

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 368

Detailed signature matches

  1. Family IPR017390
    Ubiquitinyl hydrolase, UCH37 type
    1. PIRSF038120 (Uch)
  2. Domain IPR001578
    Peptidase C12, ubiquitin carboxyl-terminal hydrolase
    1. PF01088 (Peptidase_C12)
    2. G3DSA:3.40.53...
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF54001 (Cysteine ...)
  2. cd09617 (Peptidase_...)
  3. mobidb-lite (disord...)

Residue annotation

  1. cancer-causing mut...
  2. catalytic site cd0...

Protein sequence

>MCA_01420_1
MSESSWNTIESDAGIFTELIEQLGVKGLQFEELLSIDSDSLRSVDPLLGVIFLFKYRRSEFEELKKKQQQQLQSQSTPQP
QDGHYDEISGSISSMDDPSLSVFFAHQVIQNACATQAVLSLLMNLKISKSSSSSEGTVEGNSIFENISLGPELTNFKEFV
DTFDPELRGEAISNSDTIRAVHNSFSRPSSYIDDEKPQDDSNRDEENDGLYHFISYLPINGKLYELDGLHPYPIIHTEFT
SSSGKTEPIECTLDNFPELLAQVLSRRIARAPDGDLRFNLLGLTQDKRILYQELGDVEGLQREQEKREMWRHENLLRRAN
YTPLITQLIRGIISKKQYTEESWAKDVIENAQKKSYERSMKAHNREID

GO term prediction

Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process
GO:0016579 protein deubiquitination

Molecular Function

GO:0004843 thiol-dependent ubiquitin-specific protease activity

Cellular Component

GO:0005622 intracellular