Protein
MCA_01392_1
Length
75 amino acids
Gene name: DAD4
Description: DASH complex subunit DAD4
Browser: contigA:4348468-4348831-
RNA-seq: read pairs 784, FPKM 127.5, percentile rank 82.6% (100% = highest expression)
Protein function
| Annotation: | DAD4 | DASH complex subunit DAD4 | |
|---|---|---|---|
| KEGG: | K11569 | DAD4 | DASH complex subunit DAD4 |
| EGGNOG: | 0PSNH | DAD4 | Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore |
| SGD closest match: | S000007604 | DAD4 | DASH complex subunit DAD4 |
| CGD closest match: | CAL0000190531 | DAD4 | Dad4p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XFD6_GEOCN | 63.89% | 72 | 4e-29 | Similar to Saccharomyces cerevisiae YDR320C-A DAD4 Essential subunit of the Dam1 complex (Aka DASH complex) OS=Geotrichum candidum GN=BN980_GECA13s02936g PE=4 SV=1 |
| UniRef50_A0A0E9N8F9 | 56.34% | 71 | 2e-21 | Uncharacterized protein n=9 Tax=Ascomycota TaxID=4890 RepID=A0A0E9N8F9_9ASCO |
| MIA_02497_1 | 56.94% | 72 | 2e-23 | MIA_02497_1 |
| A0A1E4TA15_9ASCO | 46.48% | 71 | 6e-21 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_52620 PE=4 SV=1 |
| A0A1D8PTL5_CANAL | 50.67% | 75 | 2e-20 | Dad4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DAD4 PE=4 SV=1 |
| DAD4_YEAST | 47.22% | 72 | 3e-18 | DASH complex subunit DAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAD4 PE=1 SV=1 |
| A0A1E3PRV7_9ASCO | 46.27% | 67 | 6e-18 | DASH complex subunit Dad4 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_14373 PE=4 SV=1 |
| DAD4_YARLI | 40.28% | 72 | 3e-15 | DASH complex subunit DAD4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DAD4 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1556
Protein family membership
- DASH complex subunit Dad4 (IPR013959)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF08650 (DASH_Dad4)
-
no IPR
Unintegrated signatures
Protein sequence
>MCA_01392_1 MENPHEQEQKALLARIIGNVQKLNESIQDVNQSLSTINHENVNIELVAQMWETYEKNVKFQLENVGQLQKPFGEK
GO term prediction
Biological Process
GO:0008608 attachment of spindle microtubules to kinetochore
Molecular Function
None predicted.
Cellular Component
GO:0042729 DASH complex
GO:0072686 mitotic spindle