MCA_01339_1
Gene name: TUB4
Description: Tubulin gamma chain
Browser: contigA:4189729-4191143-
RNA-seq: read pairs 723, FPKM 19.9, percentile rank 41.3% (100% = highest expression)
Protein function
| Annotation: | TUB4 | Tubulin gamma chain | |
|---|---|---|---|
| KEGG: | K10389 | TUBG | tubulin gamma |
| EGGNOG: | 0PFDU | TUB4 | Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome (By similarity) |
| SGD closest match: | S000001857 | TUB2 | Tubulin beta chain |
| CGD closest match: | CAL0000176403 | TUB2 | Tubulin beta chain |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00456_1 | 80.18% | 454 | 0.0 | MIA_00456_1 |
| A0A0J9X9R4_GEOCN | 80.22% | 445 | 0.0 | Tubulin gamma chain OS=Geotrichum candidum GN=BN980_GECA06s01748g PE=3 SV=1 |
| A0A060T8B6_BLAAD | 75.33% | 454 | 0.0 | Tubulin gamma chain OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C28072g PE=3 SV=1 |
| UniRef50_Q9Y882 | 67.04% | 443 | 0.0 | Tubulin gamma chain n=15 Tax=Eukaryota TaxID=2759 RepID=TBG_SCHJP |
| Q6CFF9_YARLI | 66.08% | 451 | 0.0 | Tubulin gamma chain OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B07381g PE=3 SV=1 |
| A0A1E4TLU8_9ASCO | 62.25% | 453 | 0.0 | Tubulin gamma chain OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1330 PE=3 SV=1 |
| A0A167FNJ2_9ASCO | 78.51% | 363 | 0.0 | Tubulin gamma chain OS=Sugiyamaella lignohabitans GN=TUB4 PE=3 SV=1 |
| A0A1E3PLW6_9ASCO | 61.65% | 412 | 1e-165 | Tubulin gamma chain OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45893 PE=3 SV=1 |
| A0A1D8PC97_CANAL | 36.43% | 442 | 6e-96 | Tubulin beta chain OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUB2 PE=3 SV=1 |
| TBB_YEAST | 36.65% | 442 | 7e-95 | Tubulin beta chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUB2 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0796
Protein family membership
- Tubulin (IPR000217)
- Gamma tubulin (IPR002454)
Domains and repeats
-
Domain
-
Domain
-
Domain
Detailed signature matches
no IPR
Residue annotation
-
oligomer interface...
-
nucleotide binding...
Protein sequence
>MCA_01339_1 MPRELITIQTGQCGNQIGSQFWQQLCLEHGISPDGTLQTSDNSSTLRDRKDVFFYQSDDTRYIPRSILVDLEPRVVNSIM TGSHSKMFNPDNVYISPDGGGAGNIWAAGYHAGEGISDILMDMLDREADGSDSLEGFMLLHSIAGGTGSGLGSFLLEHIN DRFPKKLIQTYSVFPDSHQISDVVVQPYNSILTLKRLALYADSVIVLDNAALTRIAADTLKVQSPTLSQTNQLVSTVMSA STSTLRYPGYLHNDLASIMASLIPLHSCHFLMTAYTPFSNDTVDQAKLVRKTTILDVMSRLLQPKTRMISLNPSKTGRYL SILNIIQGEVDSREIHKSLLRIRERNLVSFIDSVPASIQISLSKRSPYLKSGAASRISGLMLANHTSMASLFQRTLDQFE RLLKRQAFLEQYKKQPMFENGLEEFEDAREHVKHLINSYKQLEYQHTE
GO term prediction
Biological Process
GO:0007017 microtubule-based process
GO:0007020 microtubule nucleation
GO:0031122 cytoplasmic microtubule organization
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
Cellular Component
GO:0000930 gamma-tubulin complex
GO:0005874 microtubule