MCA_01331_1
Gene name: PAN3
Description: PAB-dependent poly(A)-specific ribonuclease subunit Pan3; essential subunit of the Pan2p-Pan3p poly(A)-ribonuclease complex, contains a protein kinase domain
Browser: contigA:4166671-4168982+
RNA-seq: read pairs 1948, FPKM 37.1, percentile rank 58.7% (100% = highest expression)
Protein function
| Annotation: | PAN3 | PAB-dependent poly(A)-specific ribonuclease subunit Pan3; essential subunit of the Pan2p-Pan3p poly(A)-ribonuclease complex, contains a protein kinase domain | |
|---|---|---|---|
| KEGG: | K12572 | PAN3 | PAB-dependent poly(A)-specific ribonuclease subunit 3 |
| EGGNOG: | 0PHHT | PAN3 | Regulatory subunit of the poly(A)-nuclease (PAN) deadenylation complex involved in cytoplasmic mRNA turnover. PAN specifically shortens poly(A) tails of RNA when the poly(A) stretch is bound by polyadenylate-binding protein pab1. Deadenylation of the 3'-tail to a length that is too short to bind pab1 induces mRNA decay. May also be involved in post- transcriptional maturation of mRNA poly(A) tails. pan3 acts as a positive regulator for PAN activity, recruiting pan2 to mRNA via its interaction with pab1 (By similarity) |
| SGD closest match: | S000001508 | PAN3 | PAB-dependent poly(A)-specific ribonuclease subunit PAN3 |
| CGD closest match: | CAL0000174293 | PAN3 | PAB-dependent poly(A)-specific ribonuclease subunit PAN3 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04690_1 | 61.07% | 655 | 0.0 | MIA_04690_1 |
| A0A0J9XHI5_GEOCN | 47.98% | 644 | 0.0 | Similar to Saccharomyces cerevisiae YKL025C PAN3 Essential subunit of the Pan2p-Pan3p poly(A)-ribonuclease complex (Partial) (Fragment) OS=Geotrichum candidum GN=BN980_GECA16s02474g PE=3 SV=1 |
| UniRef50_A0A0J9XHI5 | 47.98% | 644 | 0.0 | Similar to Saccharomyces cerevisiae YKL025C PAN3 Essential subunit of the Pan2p-Pan3p poly(A)-ribonuclease complex (Partial) (Fragment) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHI5_GEOCN |
| A0A060T864_BLAAD | 45.31% | 640 | 9e-174 | PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Blastobotrys adeninivorans GN=PAN3 PE=3 SV=1 |
| A0A167EFD2_9ASCO | 52.24% | 469 | 1e-170 | PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Sugiyamaella lignohabitans GN=PAN3 PE=3 SV=1 |
| A0A1E3PQS4_9ASCO | 37.12% | 660 | 6e-130 | PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=PAN3 PE=3 SV=1 |
| PAN3_YARLI | 41.96% | 448 | 6e-109 | PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAN3 PE=3 SV=1 |
| A0A1E4TD57_9ASCO | 36.95% | 452 | 1e-82 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27837 PE=4 SV=1 |
| PAN3_CANAL | 36.03% | 458 | 3e-76 | PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAN3 PE=3 SV=2 |
| PAN3_YEAST | 32.02% | 484 | 4e-65 | PAB-dependent poly(A)-specific ribonuclease subunit PAN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN3 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3398
Protein family membership
Domains and repeats
-
Domain
Detailed signature matches
no IPR
-
-
-
cd00180 (PKc)
-
mobidb-lite (disord...)
Residue annotation
-
polypeptide substr...
-
active site cd00180
-
ATP binding site c...
Protein sequence
>MCA_01331_1 MSSSKSNPSDSLHSGSSKVFSHPSASTTPCRNILIHGYCKFADKGCAFNHDAQQQSSAPVASANFKKKLNTEAPAFNTLA TFSPSNNSTTSFTSTPLTPNNQTSANPKISPSISSISPFIPKNFQSSSQLSVDSTPSTGLFTPESYQQGHSPDVQTLSTQ LSQSRLDEYSPQYDMIQGSSMEYGGMPAQQDFYYQPHTVYPLQYHLYAPNSYRNLHLTPHQRIPENYFISNELREELQRK NEASLQTLGSSSLPEYVHVYHTLVPLDTTFEKSAWGFGYPSWIYKAASNRDGNLYALRRIEGFRLTNEKAMGSVAQWNKL QCPNVVKLKEAFTTKAFGDNSLVFVYDYHPMSRTMMSVYFGPEMYQQMNRVSIPEQQIWTFITQILSALRAIHRANLAAK IIEPSRILLTDTNVIRLNCCGVFDVLHYEVQRPLESYQQEDILNFGKLILSLCEMSLAAPQYLDEALDNVENNYSPQLHK FLSTILEQPTDTEVSPAEKLQTLLQLSTDKVYDSFGQMLEYNNYILGQLSTELENGRLARLLCKLGAINERPEYNNDPAW SDTGKRYPLKLFRDYVFHQTDALGTPVVDLGHMLRELNKLDAGIDEPVMLVSRDQQTFMIVTYKELKECVGSAFRELRGP PPPPSERM
GO term prediction
Biological Process
GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening
GO:0006397 mRNA processing
GO:0006468 protein phosphorylation
Molecular Function
GO:0003723 RNA binding
GO:0004672 protein kinase activity
GO:0005524 ATP binding
GO:0046872 metal ion binding
Cellular Component
GO:0031251 PAN complex