Filter view on
Entry type
Status
Per-residue features
Colour by
Protein
MCA_01296_1
Length
660 amino acids
Browser: contigA:4073116-4075099+
RNA-seq: read pairs 2877, FPKM 53.8, percentile rank 66.8% (100% = highest expression)
Protein function
EGGNOG: | 0PJKR | PGUG_05418 | transporter |
---|---|---|---|
SGD closest match: | S000001704 | MCH2 | Probable transporter MCH2 |
CGD closest match: | CAL0000197279 | orf19.4337 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01865_1 | 61.93% | 436 | 2e-175 | MIA_01865_1 |
UniRef50_J3K9L7 | 37.05% | 413 | 3e-73 | MFS transporter n=36 Tax=Eurotiomycetidae TaxID=451871 RepID=J3K9L7_COCIM |
A0A1E3PRR6_9ASCO | 35.57% | 433 | 1e-74 | MFS general substrate transporter OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48771 PE=4 SV=1 |
Q6C0D7_YARLI | 35.59% | 413 | 1e-67 | YALI0F25619p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F25619g PE=4 SV=1 |
A0A0J9XJQ7_GEOCN | 34.48% | 435 | 1e-66 | Similar to Saccharomyces cerevisiae YNL125C ESBP6 Protein with similarity to monocarboxylate permeases OS=Geotrichum candidum GN=BN980_GECA20s00164g PE=4 SV=1 |
A0A1D8PNK9_CANAL | 35.34% | 399 | 2e-63 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4337 PE=4 SV=1 |
MCH2_YEAST | 31.45% | 442 | 3e-60 | Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 |
A0A1E4TCK1_9ASCO | 29.08% | 368 | 2e-45 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32724 PE=4 SV=1 |
A0A060TFW4_BLAAD | 28.77% | 365 | 2e-33 | ARAD1D17842p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D17842g PE=4 SV=1 |
A0A167FRE1_9ASCO | 28.88% | 374 | 2e-24 | Mch5p OS=Sugiyamaella lignohabitans GN=MCH5 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0031
Protein family membership
- Major facilitator superfamily (IPR011701)
Domains and repeats
-
Domain216 - 617
- Major facilitator superfamily domain (IPR020846)
1
100
200
300
400
500
600
660
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)298 - 303351 - 361554 - 5641 - 231491 - 501611 - 660414 - 433
-
422 - 638227 - 421
-
NON_CYTOPLASM... (N...)383 - 393522 - 526460 - 470585 - 589264 - 274324 - 328
-
329 - 351558 - 580523 - 545364 - 386396 - 413471 - 490233 - 255434 - 456590 - 609275 - 297302 - 324497 - 519
-
TRANSMEMBRANE (Tran...)232 - 263590 - 610527 - 553502 - 521362 - 382304 - 323434 - 459329 - 350275 - 297471 - 490565 - 584394 - 413
-
mobidb-lite (disord...)1 - 54181 - 21683 - 152
Residue annotation
-
putative substrate...248Wputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)251Sputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)252Gputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)253Sputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)255Gputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)256Iputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)279Gputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)282Qputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)283Fputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)286Gputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)290Sputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)291Pputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)293Iputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)294Iputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)341Lputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)342Gputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)345Fputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)346Iputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)349Nputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)350Aputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)353Pputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)364Nputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)365Gputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)368Tputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)369Sputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)375Sputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)447Tputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)450Cputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)451Yputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)454Vputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)455Lputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)458Mputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)472Gputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)476Sputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)480Sputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)483Lputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)487Rputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)535Gputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)538Iputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)539Sputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)542Sputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)546Pputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)547Pputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)550Aputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)561Lputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)562Lputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)565Sputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)566Wputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)570Gputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)571Aputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)574Iputative substrate translocation pore
248W, 251S, 252G, 253S, 255G, 256I, 279G, 282Q, 283F, 286G, 290S, 291P, 293I, 294I, 341L, 342G, 345F, 346I, 349N, 350A, 353P, 364N, 365G, 368T, 369S, 375S, 447T, 450C, 451Y, 454V, 455L, 458M, 472G, 476S, 480S, 483L, 487R, 535G, 538I, 539S, 542S, 546P, 547P, 550A, 561L, 562L, 565S, 566W, 570G, 571A, 574I
CDD
cd06174 (MFS)
Protein sequence
>MCA_01296_1 MPNHNHQESNETSFNISHEDYSSSSNSLNNTHNMHHTNHQLHQNHHHHSSNANQHIASDEITIPPNSGIAGGEIIWAEEE AEITSDSNRYNDTKEKSPNTHINTGSSSKTTESQESGQAFSSNMIQKSSSKTSFPTIHENNTNGNINDTNENNKTNYQIT LEENLYDNLGTCEKAENRNLYASDNDNNSNNNNNNNDNSNNNSNSNNNNNEKPQEEADILDSAGQIKFDRGYAWVVCLAG TFINAFSWGASGSFGIFLATYLSSNMYPGATREDFAFVGGLQFGVGLMISPLIIYIVQYVRYSVVICVGACLQAAAYIAA SYATEKWHLFLTQGVLSGIGLGTVFIPANAAIPQWFVKRRGVANGIFTSGAGLGSIIFSLSVQALIDKIGLRWAQRYVGF FTLGACILCGLLVRERKEIPKKKLAAFKFSLLKLGYIWLVIIWGAITMFCYGIVLYTMAPFAVNIGLTHQQGSVLSAIFS TGLIIGRPVLGHLADTIGSINAGMVSTLLSSLFILAWWIPANSYGSLIALNLILGSVISAFSVGFPPICASLVKLQDLSA LLSMSWPIIGAINIFSTPTAIGLTKIDGTYLYSQILTGLLFFVSFLILLVTRGIRIRLAENIKLRDEKEESSETNMEISS GDKPYKQEPFYKLMFKFTKL
GO term prediction
Biological Process
GO:0055085 transmembrane transport
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane