Protein
MCA_01162_1
Length
117 amino acids
Gene name: NHP6B
Description: Non-histone chromosomal protein 6; contains HMG box domain
Browser: contigA:3679506-3679860+
RNA-seq: read pairs 4891, FPKM 512.1, percentile rank 94.3% (100% = highest expression)
Protein function
| Annotation: | NHP6B | Non-histone chromosomal protein 6; contains HMG box domain | |
|---|---|---|---|
| EGGNOG: | 0PRUP | NHP6 | DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex |
| SGD closest match: | S000002157 | NHP6B | Non-histone chromosomal protein 6B |
| CGD closest match: | CAL0000201490 | NHP6 | Non-histone chromosomal protein 6 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| NHP6B_YEAST | 58.67% | 75 | 2e-20 | Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6B PE=1 SV=3 |
| UniRef50_P11633 | 58.67% | 75 | 5e-17 | Non-histone chromosomal protein 6B n=7 Tax=Saccharomyces TaxID=4930 RepID=NHP6B_YEAST |
| A0A167EYL2_9ASCO | 58.67% | 75 | 1e-18 | Nhp6bp OS=Sugiyamaella lignohabitans GN=NHP6B PE=4 SV=1 |
| NHP6_CANAL | 64.79% | 71 | 1e-18 | Non-histone chromosomal protein 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NHP6 PE=3 SV=1 |
| MIA_05499_1 | 57.89% | 76 | 5e-18 | MIA_05499_1 |
| A0A060SYZ3_BLAAD | 56.58% | 76 | 1e-17 | ARAD1A15532p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A15532g PE=4 SV=1 |
| A0A0J9X4V4_GEOCN | 54.67% | 75 | 2e-17 | Similar to Saccharomyces cerevisiae YBR089C-A NHP6B High-mobility group (HMG) protein, binds to and remodels nucleosomes OS=Geotrichum candidum GN=BN980_GECA02s06335g PE=4 SV=1 |
| A0A1E3PEI4_9ASCO | 59.15% | 71 | 1e-16 | Non-histone chromosomal protein 6 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_28285 PE=4 SV=1 |
| NHP6_YARLI | 55.41% | 74 | 1e-16 | Non-histone chromosomal protein 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NHP6 PE=3 SV=1 |
| A0A1E4THC9_9ASCO | 55.41% | 74 | 4e-16 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31873 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4215
Predicted cleavage: 13
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
20
40
60
80
100
117
Detailed signature matches
no IPR
Unintegrated signatures
-
-
PR00886 (HIGHMOBLTY12)
-
cd01390 (HMGB-UBF_H...)
-
mobidb-lite (disord...)
Residue annotation
-
DNA binding site c...
Protein sequence
>MCA_01162_1 MPKESTTTTRRRAAKAAPVEDVEETVTKKKTTRRSTKKEKDPNAPKRFLSAYMFFANENRDTVKAENPDATFGGLGKLLG EKWKSMDENDKKPYEDMAKKDRERYEKQMETYRSSKE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.