Protein

MCA_01052_2

Length
129 amino acids

Gene name: RPL26A

Description: 60S ribosomal protein L26-A; mitochondrial presequence

Browser: contigA:3357374-3358162+

RNA-seq: read pairs 45259, FPKM 4301.7, percentile rank 99.3% (100% = highest expression)

Protein function

Annotation:RPL26A60S ribosomal protein L26-A; mitochondrial presequence
KEGG:K02898RP-L26e large subunit ribosomal protein L26e
EGGNOG:0PPNWFG10845.160S ribosomal protein l26
SGD closest match:S000004336RPL26A60S ribosomal protein L26-A
CGD closest match:CAL0000201086orf19.3690.2Ribosomal 60S subunit protein L26B

Protein alignments

%idAln lengthE-value
MIA_03138_182.95%1291e-74MIA_03138_1
A0A1E3PJH5_9ASCO73.64%1292e-64Ribosomal protein L24 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47103 PE=3 SV=1
A0A1D8PCQ5_CANAL69.29%1272e-57Ribosomal 60S subunit protein L26B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3690.2 PE=4 SV=1
A0A060T8V6_BLAAD68.50%1271e-56ARAD1D10582p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D10582g PE=4 SV=1
RL26A_YEAST66.14%1276e-5760S ribosomal protein L26-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL26A PE=1 SV=3
UniRef50_P5322166.14%1271e-5360S ribosomal protein L26-B n=62 Tax=Eukaryota TaxID=2759 RepID=RL26B_YEAST
Q6C540_YARLI62.79%1291e-52YALI0E21219p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E21219g PE=4 SV=1
A0A0J9XGI3_GEOCN68.55%1241e-48Similar to Saccharomyces cerevisiae YGR034W RPL26B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA13s01682g PE=3 SV=1
A0A1E4T9C5_9ASCO64.34%1291e-46Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32971 PE=4 SV=1
A0A167DNB2_9ASCO70.71%997e-45Ribosomal 60S subunit protein L26B OS=Sugiyamaella lignohabitans GN=RPL26B PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9945
Predicted cleavage: 14

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 20 40 60 80 100 129

Detailed signature matches

  1. Family IPR005756
    Ribosomal protein L26/L24, eukaryotic/archaeal
    1. MF_01326_A (Ribosom...)
    2. PF16906 (Ribosomal_L26)
    3. TIGR01080
  2. Domain IPR014722
    Ribosomal protein L2 domain 2
    1. G3DSA:2.30.30.30
  3. Domain IPR008991
    Translation protein SH3-like domain
    1. SSF50104 (Translati...)
  4. Domain IPR005824
    KOW
    1. SM00739 (kow_9)
    2. PF00467 (KOW)
  5. SITE IPR005825
    Ribosomal protein L24/L26, conserved site
    1. PS01108 (RIBOSOMAL_L24)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd06089 (KOW_RPL26)
  2. mobidb-lite (disord...)

Residue annotation

  1. RNA binding site c...

Protein sequence

>MCA_01052_2
MAKVSTAVSSSRRKARKAHFTAPSHVRRVIMSAPLSKELREQYKVKSVPVHKGDEVQVVRGSNKGREGKITQVYRLKWSI
QLEKLVKEKANGAAVPLNIHPSNVVITKLNNDKDRFALIAAKGGKVDSE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome
GO:0015934 large ribosomal subunit