Protein

MIA_03138_1

Length
129 amino acids


Browser: contig04:321464-322120+

Protein function

EGGNOG:0PPNWFG10845.160S ribosomal protein l26
SGD closest match:S000004336RPL26A60S ribosomal protein L26-A
CGD closest match:CAL0000201086orf19.3690.2Ribosomal 60S subunit protein L26B

Protein alignments

%idAln lengthE-value
A0A1E3PJH5_9ASCO77.895%951.49e-53Ribosomal protein L24 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47103 PE=3 SV=1
UniRef50_Q4WM4273.958%969.05e-43Ribosomal protein L26 n=4 Tax=leotiomyceta TaxID=716546 RepID=Q4WM42_ASPFU
A0A060T8V6_BLAAD69.792%962.14e-47ARAD1D10582p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D10582g PE=4 SV=1
A0A0J9XGI3_GEOCN71.875%963.31e-47Similar to Saccharomyces cerevisiae YGR034W RPL26B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA13s01682g PE=3 SV=1
RL26A_YEAST69.792%961.81e-4560S ribosomal protein L26-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL26A PE=1 SV=3
A0A1D8PCQ5_CANAL69.792%963.14e-44Ribosomal 60S subunit protein L26B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3690.2 PE=4 SV=1
A0A1E4T9C5_9ASCO64.583%961.57e-42Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32971 PE=4 SV=1
A0A167DNB2_9ASCO73.810%841.46e-40Ribosomal 60S subunit protein L26B OS=Sugiyamaella lignohabitans GN=RPL26B PE=4 SV=1
Q6C540_YARLI58.333%964.74e-40YALI0E21219p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E21219g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9865
Predicted cleavage: 14

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 20 40 60 80 100 129

Detailed signature matches

    1. PF16906 (Ribosomal_L26)
    1. SSF50104 (Translati...)
    1. SM00739 (kow_9)
    2. PF00467 (KOW)
    1. PS01108 (RIBOSOMAL_L24)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd06089 (KOW_RPL26)
  2. mobidb-lite (disord...)

Residue annotation

  1. RNA binding site c...

Protein sequence

>MIA_03138_1
MAKVSTAVSSSRSKARKAHFTAPSHVRRVILSAPLSKELREQYKVRSLPVHKDDEVQVVRGSLKGREGKITQVYRLKWAV
QIEKVVKEKSNAATVPINIHPSNVVITKLSGDKDRAALIAARGGAAAQE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome
GO:0015934 large ribosomal subunit