Protein
MCA_01016_1
Length
269 amino acids
Gene name: USB1
Description: U6 snRNA phosphodiesterase
Browser: contigA:3225605-3226541+
RNA-seq: read pairs 279, FPKM 12.8, percentile rank 30.6% (100% = highest expression)
Protein function
Annotation: | USB1 | U6 snRNA phosphodiesterase | |
---|---|---|---|
EGGNOG: | 0PQ32 | USB1 | Phosphodiesterase responsible for the U6 snRNA 3' end processing. Acts as an exoribonuclease (RNase) responsible for trimming the poly(U) tract of the last nucleotides in the pre-U6 snRNA molecule, leading to the formation of mature U6 snRNA (By similarity) |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A1E3PKL3_9ASCO | 33.67% | 199 | 2e-28 | Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_7552 PE=4 SV=1 |
UniRef50_A0A1E3PKL3 | 33.67% | 199 | 6e-25 | Uncharacterized protein (Fragment) n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PKL3_9ASCO |
A0A0J9XFB6_GEOCN | 28.74% | 247 | 8e-27 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA13s00769g PE=4 SV=1 |
A0A060T325_BLAAD | 31.82% | 198 | 1e-23 | ARAD1C37466p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C37466g PE=4 SV=1 |
Q6C5L7_YARLI | 37.43% | 187 | 2e-23 | U6 snRNA phosphodiesterase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=USB1 PE=3 SV=1 |
A0A161HM91_9ASCO | 32.16% | 171 | 4e-15 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_2344 PE=4 SV=1 |
MIA_01971_1 | 26.90% | 197 | 1e-13 | MIA_01971_1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0360
Protein family membership
- U6 snRNA phosphodiesterase Usb1 (IPR027521)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_01016_1 MNLVGYSDSSDSSDTDSEQSNYLNINTSQNVQSLKPSLPLSFHSIYTANSKFASGSHLYDGKSRVSAHVEGSWPTHIYLQ WIPSDSDYDRLLKIFSYIQHHCLPDYHIHSLIESELKVPQILHVSLSKTLMIPGNKVKLFQDSVENCIKGFNFDFKRIEF DPSHFLILPNENNTRFFVVLVLTGNSQLQIRSLIATLNSLISDSFNQPTLPTDLPHISIGWFTLESSLNFPESKILIDDS SIQKIISSFEWIPQDILLKSGKSASRIDL
GO term prediction
Biological Process
GO:0034477 U6 snRNA 3'-end processing
Molecular Function
GO:0004518 nuclease activity
Cellular Component
None predicted.