Protein

MCA_00879_2

Length
315 amino acids

Gene name: PRX1

Description: Mitochondrial peroxiredoxin PRX1

Browser: contigA:2769205-2770153-

RNA-seq: read pairs 13774, FPKM 538.6, percentile rank 94.5% (100% = highest expression)

Protein function

Annotation:PRX1Mitochondrial peroxiredoxin PRX1
KEGG:K03386PRDX2_4 peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
EGGNOG:0PFVXPGUG_03867mitochondrial peroxiredoxin Prx1
SGD closest match:S000000160PRX1Mitochondrial peroxiredoxin PRX1
CGD closest match:CAL0000196398PRX1Thioredoxin peroxidase

Protein alignments

%idAln lengthE-value
MIA_06086_168.24%2967e-137MIA_06086_1
A0A0J9XA47_GEOCN79.30%2271e-130Similar to Saccharomyces cerevisiae YBL064C PRX1 Mitochondrial peroxiredoxin (1-Cys Prx) with thioredoxin peroxidase activity, has a role in reduction of hydroperoxides OS=Geotrichum candidum GN=BN980_GECA05s05202g PE=4 SV=1
A0A060T3K8_BLAAD73.57%2272e-124ARAD1C38082p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C38082g PE=4 SV=1
Q6C2G0_YARLI70.93%2272e-118YALI0F08195p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F08195g PE=4 SV=1
A0A1E3PNK9_9ASCO68.18%2429e-118Thioredoxin-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81635 PE=4 SV=1
A0A167CJS0_9ASCO69.57%2308e-116Prx1p OS=Sugiyamaella lignohabitans GN=PRX1 PE=4 SV=1
UniRef50_A0A194XBV061.70%2354e-101AhpC/TSA family thioredoxin peroxidase n=21 Tax=leotiomyceta TaxID=716546 RepID=A0A194XBV0_9HELO
PRX1_YEAST60.96%2285e-98Mitochondrial peroxiredoxin PRX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRX1 PE=1 SV=1
A0A1E4TB15_9ASCO57.02%2359e-91Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_58020 PE=4 SV=1
Q5A5A0_CANAL53.78%2252e-83Thioredoxin peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRX1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9935
Predicted cleavage: 48

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 315

Detailed signature matches

  1. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
  2. Domain IPR013766
    Thioredoxin domain
    1. PS51352 (THIOREDOXIN_2)
  3. Domain IPR000866
    Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant
    1. PF00578 (AhpC-TSA)
  4. Domain IPR019479
    Peroxiredoxin, C-terminal
    1. PF10417 (1-cysPrx_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.10...
  2. G3DSA:3.40.30.10
  3. SFLDS00024 (Peroxir...)
  4. cd03016 (PRX_1cys)

Residue annotation

  1. dimer interface cd...
  2. decamer (pentamer ...
  3. SFLDS00024
  4. catalytic triad cd...

Protein sequence

>MCA_00879_2
MSAILRRSIASSRLLTRAATISKPTASSSFLLRPRYFTQEAQPRIRIGSTAPNFKAVTTEGEIDFHEWIGDSWAILFSHP
ADFTPVCTTELGAFSQLKDEFAKRNAKLIGLSVDPLEDHTKWVKDIEEVVLDNKPFNFPIISDADRKVSFLYDMVDQQGF
ESLTNPDGSKNVAFTIRNVFIIDPSKKVRLFIVYPASTGRNTAEVLRVLDALQLTDKSGLVTPVNWTEGKDVIIPPSVKN
EEAAQKYGEFKEVKPYLRFTKAPTLKSSFLGSDSSSAFGYGRLILGATLVSGLVLSTFDEKDLSKVGQLNRVFEK

GO term prediction

Biological Process

GO:0045454 cell redox homeostasis
GO:0055114 oxidation-reduction process

Molecular Function

GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity

Cellular Component

None predicted.