MCA_00865_1
Gene name: PUP3
Description: Proteasome subunit beta type-3
Browser: contigA:2731969-2732747-
RNA-seq: read pairs 3719, FPKM 223.1, percentile rank 89.3% (100% = highest expression)
Protein function
| Annotation: | PUP3 | Proteasome subunit beta type-3 | |
|---|---|---|---|
| KEGG: | K02735 | PSMB3 | 20S proteasome subunit beta 3 [EC:3.4.25.1] |
| EGGNOG: | 0PHSV | PUP3 | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity) |
| SGD closest match: | S000000896 | PUP3 | Proteasome subunit beta type-3 |
| CGD closest match: | CAL0000180706 | PUP3 | Proteasome core particle subunit beta 3 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X3P5_GEOCN | 83.01% | 206 | 6e-128 | Similar to Saccharomyces cerevisiae YER094C PUP3 Beta 3 subunit of the 20S proteasome involved in ubiquitin-dependent catabolism OS=Geotrichum candidum GN=BN980_GECA01s11351g PE=4 SV=1 |
| MIA_06073_1 | 89.01% | 191 | 2e-127 | MIA_06073_1 |
| A0A060T0R0_BLAAD | 78.05% | 205 | 1e-124 | ARAD1C10318p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C10318g PE=4 SV=1 |
| A0A1E3PNM7_9ASCO | 77.56% | 205 | 5e-122 | N-terminal nucleophile aminohydrolase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49473 PE=4 SV=1 |
| A0A167CM50_9ASCO | 82.72% | 191 | 5e-121 | Proteasome core particle subunit beta 3 OS=Sugiyamaella lignohabitans GN=PUP3 PE=4 SV=1 |
| PSB3_YEAST | 76.10% | 205 | 2e-118 | Proteasome subunit beta type-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP3 PE=1 SV=1 |
| UniRef50_P25451 | 76.10% | 205 | 5e-115 | Proteasome subunit beta type-3 n=326 Tax=Eukaryota TaxID=2759 RepID=PSB3_YEAST |
| A0A1D8PRB6_CANAL | 75.73% | 206 | 1e-114 | Proteasome core particle subunit beta 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PUP3 PE=4 SV=1 |
| A0A1E4TGV7_9ASCO | 72.20% | 205 | 1e-113 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_24172 PE=4 SV=1 |
| Q6C0R7_YARLI | 76.21% | 206 | 4e-111 | YALI0F22341p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F22341g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0133
Protein family membership
- Proteasome, subunit alpha/beta (IPR001353)
- Proteasome B-type subunit (IPR023333)
- Proteasome beta 3 subunit (IPR033811)
- Proteasome B-type subunit (IPR023333)
Domains and repeats
-
Domain
Detailed signature matches
Residue annotation
-
active site cd03759
-
beta subunit inter...
Protein sequence
>MCA_00865_1 MSNPSEINGGSVVAMTGKDCIAIACDLRLGMQSIGISNNFEKIFNYGNIYLGLTGLATDVISLSEVFRLKTNLYKMKEGR DIEPDTFANLVSSTLYQKRFGPYFIGPVVAGLNSKTGKPFICSFDLIGNIDFAQDFAVAGTASDQLFGMCESLWEPDLEP EELFEIISQSLLNAVDRDALSGWGAVVYIVTKDKVTKRLLKTRQD
GO term prediction
Biological Process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in cellular protein catabolic process
Molecular Function
GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity
Cellular Component
GO:0005839 proteasome core complex
GO:0019774 proteasome core complex, beta-subunit complex