Protein

MCA_00737_1

Length
296 amino acids


Browser: contigA:2302497-2303510+

RNA-seq: read pairs 6879, FPKM 286.2, percentile rank 91.5% (100% = highest expression)

Protein function

KEGG:K00797speE spermidine synthase [EC:2.5.1.16]
EGGNOG:0PHI1PGUG_05047Spermidine synthase
SGD closest match:S000006273SPE3Spermidine synthase
CGD closest match:CAL0000181339SPE3Spermidine synthase

Protein alignments

%idAln lengthE-value
MIA_05443_191.16%2940.0MIA_05443_1
A0A060T393_BLAAD77.05%2926e-160ARAD1A07832p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07832g PE=3 SV=1
Q6C3P7_YARLI77.93%2901e-159YALI0E33143p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E33143g PE=3 SV=1
A0A1E4TAF4_9ASCO75.59%2956e-160Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_127935 PE=3 SV=1
A0A1E3PPV9_9ASCO75.43%2931e-157Putative spermidine synthase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81934 PE=3 SV=1
A0A167F5P8_9ASCO73.10%2901e-149Spermidine synthase OS=Sugiyamaella lignohabitans GN=SPE3 PE=3 SV=1
Q59Z50_CANAL73.38%2932e-148Spermidine synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPE3 PE=3 SV=1
UniRef50_Q9Y8H773.20%2915e-145Spermidine synthase n=156 Tax=Eukaryota TaxID=2759 RepID=SPEE_NEUCR
SPEE_YEAST71.92%2922e-146Spermidine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPE3 PE=1 SV=1
A0A0J9XHU3_GEOCN63.36%2924e-129Similar to Saccharomyces cerevisiae YPR069C SPE3 Spermidine synthase involved in biosynthesis of spermidine and also in biosynthesis of pantothenic acid OS=Geotrichum candidum GN=BN980_GECA15s02364g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6864

Protein family membership

Domains and repeats

1 50 100 150 200 250 296

Detailed signature matches

    1. MF_00198 (Spermidin...)
    1. PIRSF000502 (Spermi...)
    1. PF17284 (Spermine_s...)
    1. SSF53335 (S-adenosy...)
    1. PS51006 (PABS_2)
    1. PS01330 (PABS_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PF01564 (Spermine_s...)
  2. cd02440 (AdoMet_MTases)

Residue annotation

  1. S-adenosylmethioni...

Protein sequence

>MCA_00737_1
MSTELTHPSIKDGWFREISETMWPGEAMTLRVKKVLHAARSKYQDILVFESTDYGNVLVLDGAIQATERDEFAYQEMITH
LALNSHPNPKKVLVVGGGDGGVLREVLKHKSVEQAVLCDIDEMVPEVSKLYLKDMKKGFEDDRVTVHIGDGFKFLAEYKN
TFDCIITDSSDPEGPAASLFQKPYFQLLSEALTEEGVITTQAESIWLHLNIIKDLKKACKSVFPVAEYAYTTIPTYPSGQ
IGFMVCSKNPKANVRVPLRSFDDEENDKINKYYNKEIHSASFVLPTWARKTLEDEN

GO term prediction

Biological Process

GO:0006595 polyamine metabolic process

Molecular Function

GO:0003824 catalytic activity

Cellular Component

None predicted.