Protein
MCA_00623_1
Length
436 amino acids
Gene name: ARP4B
Description: Actin-related protein
Browser: contigA:1908334-1909645-
RNA-seq: read pairs 2218, FPKM 62.7, percentile rank 70.2% (100% = highest expression)
Protein function
| Annotation: | ARP4B | Actin-related protein | |
|---|---|---|---|
| KEGG: | K11400 | ARP4 | actin-related protein 4 |
| EGGNOG: | 0PFT0 | ARP4 | Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity) |
| SGD closest match: | S000001855 | ACT1 | Actin |
| CGD closest match: | CAL0000191211 | ACT1 | Actin |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01317_1 | 62.47% | 421 | 0.0 | MIA_01317_1 |
| A0A0J9X4U6_GEOCN | 55.37% | 419 | 2e-161 | Similar to Saccharomyces cerevisiae YJL081C ARP4 Nuclear actin-related protein involved in chromatin remodeling OS=Geotrichum candidum GN=BN980_GECA02s06522g PE=3 SV=1 |
| UniRef50_A0A0J9X4U6 | 55.37% | 419 | 4e-158 | Similar to Saccharomyces cerevisiae YJL081C ARP4 Nuclear actin-related protein involved in chromatin remodeling n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X4U6_GEOCN |
| A0A167C0M7_9ASCO | 45.92% | 429 | 1e-136 | Actin OS=Sugiyamaella lignohabitans GN=ACT1 PE=3 SV=1 |
| A0A1E3PFP9_9ASCO | 45.41% | 425 | 4e-125 | Actin-related protein 4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_27372 PE=3 SV=1 |
| Q6C0A9_YARLI | 42.08% | 423 | 4e-112 | YALI0F26345p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F26345g PE=3 SV=1 |
| A0A060T6C5_BLAAD | 41.59% | 440 | 1e-109 | ARAD1C18436p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C18436g PE=3 SV=1 |
| A0A1E4TII5_9ASCO | 36.54% | 416 | 2e-85 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147306 PE=3 SV=1 |
| A0A1D8PFR4_CANAL | 27.00% | 426 | 2e-48 | Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACT1 PE=3 SV=1 |
| ACT_YEAST | 26.89% | 424 | 4e-46 | Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACT1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0089
Protein family membership
- Actin family (IPR004000)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS00432 (ACTINS_2)
-
no IPR
Unintegrated signatures
-
-
-
SSF53067 (Actin-lik...)
-
cd00012 (NBD_sugar-...)
-
mobidb-lite (disord...)
Residue annotation
-
nucleotide binding...
Protein sequence
>MCA_00623_1 MTVDTPTTSSTPSGPLFKTSHADEIPSIVIENGTSMTRVGYAGEGLPRHIIPTAYGKDKDGNYSIGDSVHDFSPGKEVYS PMADGIVQDWDAITRNWDYCYNQLLDIPEEETCELPFATTETPWNTIENKNKAAEIAFEHLRVPLFSIIKKPLCTAYNSE LPTSLVVDVGAGVASVTPVVEGNIVQKGVMHTRFAGDFITYHIVRMFESKNINVVPSYRVKKKMPLELNQQPDPSVYRTD INPDTDVTSSYHSYEVSRVIDEFKETSSYVSGANLSNGSNMATPARPFEFPDGFNTMLTVERLATVEPLFKPREYHIPGI TLPDNSLGISEMVGQCLNKAELGGEVTGVLLNNIIITGGSTLFQGFSVRLRNDLDMLYQQYQAKVRVLQQNSPLAQKCSV WTGASILASLGQFDQSWVTKQEYEEFGADIIEKKFK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.