Protein

MCA_00499_2

Length
195 amino acids

Gene name: RHO1

Description: GTP-binding protein RHO1

Browser: contigA:1577087-1577908-

RNA-seq: read pairs 9123, FPKM 575.1, percentile rank 94.8% (100% = highest expression)

Protein function

Annotation:RHO1GTP-binding protein RHO1
KEGG:K04513RHOA Ras homolog gene family, member A
EGGNOG:0PFAPRHO1GTP-binding Protein
SGD closest match:S000006369RHO1GTP-binding protein RHO1
CGD closest match:CAL0000192659RHO1GTP-binding protein RHO1

Protein alignments

%idAln lengthE-value
MIA_06226_193.47%1994e-134MIA_06226_1
A0A0J9X4P3_GEOCN92.42%1981e-131Similar to Saccharomyces cerevisiae YPR165W RHO1 GTP-binding protein of the rho subfamily of Ras-like proteins, involved in establishment of cell polarity OS=Geotrichum candidum GN=BN980_GECA03s01451g PE=3 SV=1
A0A060T930_BLAAD87.82%1972e-128ARAD1C34738p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C34738g PE=3 SV=1
A0A167FEB8_9ASCO85.86%1983e-124Rho family GTPase RHO1 OS=Sugiyamaella lignohabitans GN=RHO1 PE=3 SV=1
A0A1E4TFZ1_9ASCO83.85%1922e-119Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25035 PE=3 SV=1
Q6CAP4_YARLI82.09%2013e-119YALI0D01045p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D01045g PE=3 SV=1
UniRef50_A0A061H5N181.35%1934e-112Uncharacterized protein n=102 Tax=Opisthokonta TaxID=33154 RepID=A0A061H5N1_9BASI
A0A1E3PPT3_9ASCO74.27%2064e-112Beta-1,3-glucan synthase regulatory subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81918 PE=3 SV=1
RHO1_CANAL82.70%1853e-110GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHO1 PE=3 SV=1
RHO1_YEAST78.14%1832e-104GTP-binding protein RHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO1 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0375

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 195

Detailed signature matches

  1. Family IPR001806
    Small GTPase superfamily
    1. PF00071 (Ras)
  2. Family IPR003578
    Small GTPase superfamily, Rho type
    1. PS51420 (RHO)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...
  2. G3DSA:3.40.50...
  3. PR00449 (RASTRNSFRMNG)
  4. SM00173 (ras_sub_4)
  5. SM00174 (rho_sub_3)
  6. SM00175 (rab_sub_5)
  7. cd01870 (RhoA_like)

Residue annotation

  1. GEF (guanine nucle...
  2. G1 box cd01870
  3. GTP/Mg2+ binding s...
  4. PKN/PRK1 effector ...
  5. Switch I region cd...
  6. GAP (GTPase-activa...
  7. G2 box cd01870
  8. GDI (guanine nucle...
  9. Rho kinase (ROCK) ...
  10. Mdia effector inte...
  11. G3 box cd01870
  12. Switch II region c...
  13. G4 box cd01870
  14. G5 box cd01870

Protein sequence

>MCA_00499_2
MVSPPAELRRKLVIVGDGACGKTCLVFSKGTFPQVYLPTVFENYVSDVEVDGRHVELALWDTAGQEDYDRLRPLSYPDSN
VILICFAIDSPDSLDNVQEKWISEVLHFCQGVPILLVGCKSDLRYDPKTIEELKRTSQRPVTTDEGQAVAQKIGAIKYLE
CSAKTQEGVKEVFEHATRAALMVKDKEHKKRCLIL

GO term prediction

Biological Process

GO:0007264 small GTPase mediated signal transduction

Molecular Function

GO:0003924 GTPase activity
GO:0005525 GTP binding

Cellular Component

GO:0005622 intracellular