Protein
MCA_00365_1
Length
537 amino acids
Gene name: COX15
Description: Cytochrome c oxidase assembly protein COX15
Browser: contigA:1151601-1153215-
RNA-seq: read pairs 9458, FPKM 217.2, percentile rank 89.0% (100% = highest expression)
Protein function
| Annotation: | COX15 | Cytochrome c oxidase assembly protein COX15 | |
|---|---|---|---|
| KEGG: | K02259 | COX15 | cytochrome c oxidase assembly protein subunit 15 |
| EGGNOG: | 0PFR2 | COX15 | Cytochrome c oxidase assembly protein |
| SGD closest match: | S000000943 | COX15 | Cytochrome c oxidase assembly protein COX15 |
| CGD closest match: | CAL0000185068 | COX15 | Cox15p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01428_1 | 69.26% | 540 | 0.0 | MIA_01428_1 |
| A0A0J9X3V1_GEOCN | 66.67% | 513 | 0.0 | Similar to Saccharomyces cerevisiae YER141W COX15 Protein required for the hydroxylation of heme O to form heme A, which is an essential prosthetic group for cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA02s00923g PE=3 SV=1 |
| A0A167EGW9_9ASCO | 62.20% | 418 | 8e-166 | Cox15p OS=Sugiyamaella lignohabitans GN=COX15 PE=3 SV=1 |
| UniRef50_A0A167EGW9 | 62.20% | 418 | 2e-162 | Cox15p n=9 Tax=Ascomycota TaxID=4890 RepID=A0A167EGW9_9ASCO |
| A0A1E3PG88_9ASCO | 62.86% | 412 | 2e-159 | COX15-CtaA-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43535 PE=3 SV=1 |
| A0A060SZ01_BLAAD | 50.48% | 519 | 4e-154 | ARAD1C04840p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C04840g PE=3 SV=1 |
| Q6C0H5_YARLI | 60.65% | 399 | 3e-146 | YALI0F24651p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F24651g PE=3 SV=1 |
| A0A1E4TAI9_9ASCO | 60.26% | 380 | 3e-132 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_61886 PE=3 SV=1 |
| A0A1D8PPE8_CANAL | 56.97% | 402 | 3e-127 | Cox15p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX15 PE=3 SV=1 |
| COX15_YEAST | 56.74% | 386 | 1e-126 | Cytochrome c oxidase assembly protein COX15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX15 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9983
Predicted cleavage: 95
Protein family membership
- COX15/CtaA family (IPR003780)
- Heme A synthase, type 2 (IPR023754)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_00365_1 MAIPLARSQFFFFHNAAIRAATKSCGSKFLSLAKPAPKSFSVASALIKPSRIPSSSLGSNAFSGSANRFGLASANKFGSN QTARAFSTFSSRRSSATNSAEMEKLTEEFAKTMQNSNYVKTNKRRPVNTWKPVGYWLIFTSSLVFGIVVLGGLTRLTESG LSITEWKPVTGSIPPLSQAEWEEEFEKYKSSPEFKLLNSNITLSEFKFIFFMEWSHRLVGRAIGMFVLLPAAYFIYTRKT TPHVTGKIVLITALLGLQGFIGWWMVKSGLDNKFLEEPGSHPRVSQYRLATHLFAAFLLYTAMMFTGIDIIREAEWIKNP TAAVKEIAKLDSPALRRYRSIGKFVFAFVFFTAMTGAFVAGLDAGMIYNSFPYMGETIVPPKEELFNPDYNKKSPDSSWS LFWRNMLENPTTVQFNHRVCATTAFFLVLGYHVYSLRMKHHIPRSAFRANFAMMGLASLQVCLGISTLIYVVPTPLAAAH QAGALALLTSLIFLCARLKQPRTAQRLLISALERKASKEAANKASKVFIKPQKPLSL
GO term prediction
Biological Process
GO:0006784 heme a biosynthetic process
GO:0055114 oxidation-reduction process
Molecular Function
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
Cellular Component
GO:0016020 membrane
GO:0016021 integral component of membrane