Protein

MCA_00346_1

Length
137 amino acids

Gene name: TRX1B

Description: Thioredoxin

Browser: contigA:1109244-1109658-

RNA-seq: read pairs 2338, FPKM 209.3, percentile rank 88.6% (100% = highest expression)

Protein function

Annotation:TRX1BThioredoxin
KEGG:K03671trxA thioredoxin 1
EGGNOG:0PQT5FG03946.1Thioredoxin
SGD closest match:S000004033TRX1Thioredoxin-1
CGD closest match:CAL0000180451TRX1Thioredoxin

Protein alignments

%idAln lengthE-value
UniRef50_A0A0A2LP0947.17%1063e-29Thioredoxin n=12 Tax=Penicillium TaxID=5073 RepID=A0A0A2LP09_PENIT
MIA_06006_145.71%1058e-31MIA_06006_1
A0A1E4TI34_9ASCO46.15%1042e-29Thioredoxin OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3115 PE=3 SV=1
TRX1_YEAST42.72%1037e-29Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3
A0A1D8PU69_CANAL38.68%1061e-27Thioredoxin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRX1 PE=3 SV=1
A0A060T4G9_BLAAD40.00%1052e-27Thioredoxin OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A17292g PE=3 SV=1
A0A0J9XEQ5_GEOCN50.00%783e-26Thioredoxin OS=Geotrichum candidum GN=BN980_GECA12s02155g PE=3 SV=1
A0A167EUJ2_9ASCO38.32%1078e-25Thioredoxin OS=Sugiyamaella lignohabitans GN=TRX1 PE=3 SV=1
A0A1E3PG15_9ASCO39.42%1043e-24Thioredoxin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47429 PE=3 SV=1
Q6C399_YARLI40.43%943e-23Thioredoxin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F01496g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0097

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 137

Detailed signature matches

  1. Family IPR005746
    Thioredoxin
    1. TIGR01068
    2. PIRSF000077 (Thiore...)
  2. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
  3. Domain IPR013766
    Thioredoxin domain
    1. PF00085 (Thioredoxin)
    2. PS51352 (THIOREDOXIN_2)
  4. SITE IPR017937
    Thioredoxin, conserved site
    1. PS00194 (THIOREDOXIN_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.30.10
  2. NON_CYTOPLASM... (N...)
  3. PR00421 (THIOREDOXIN)
  4. SFLDG00337 (Thiored...)
  5. SIGNAL_PEPTIDE (Sig...)
  6. SIGNAL_PEPTID... (S...)
  7. SIGNAL_PEPTID... (S...)
  8. SIGNAL_PEPTID... (S...)
  9. SignalP-noTM
  10. TMhelix
  11. cd02947 (TRX_family)

Residue annotation

  1. catalytic residues...
  2. SFLDG00337

Protein sequence

>MCA_00346_1
MDTNYIVLGIFVIFLIVQFINGRKPYPESATVKSINSQTEFNSLVINNKEGKAAILVDFYATWCGPCKAIAPVIDGMTSR
YPNIGFYKVDVDKEASIARKYDVHAMPTFVVFRNGKPIETIVGADVKKIERTLSEYS

GO term prediction

Biological Process

GO:0006662 glycerol ether metabolic process
GO:0045454 cell redox homeostasis

Molecular Function

GO:0015035 protein disulfide oxidoreductase activity

Cellular Component

None predicted.