Protein
MCA_00286_1
Length
158 amino acids
Gene name: SKP1A
Description: Suppressor of kinetochore protein 1
Browser: contigA:869616-870205-
RNA-seq: read pairs 3706, FPKM 288.0, percentile rank 91.5% (100% = highest expression)
Protein function
Annotation: | SKP1A | Suppressor of kinetochore protein 1 | |
---|---|---|---|
KEGG: | K03094 | SKP1 | S-phase kinase-associated protein 1 |
EGGNOG: | 0PN0Q | SCONC | Essential component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Controls sulfur metabolite repression, probably by mediating the inactivation or degradation of the metR transcription factor (By similarity) |
SGD closest match: | S000002736 | SKP1 | Suppressor of kinetochore protein 1 |
CGD closest match: | CAL0000178736 | SKP1 | SCF ubiquitin ligase subunit |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01348_1 | 74.68% | 158 | 5e-87 | MIA_01348_1 |
Q6CHA1_YARLI | 70.99% | 162 | 2e-83 | YALI0A10879p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A10879g PE=3 SV=1 |
A0A0J9X9G2_GEOCN | 74.21% | 159 | 3e-83 | Similar to Saccharomyces cerevisiae YDR328C SKP1 Evolutionarily conserved kinetochore protein OS=Geotrichum candidum GN=BN980_GECA06s04696g PE=3 SV=1 |
UniRef50_V5EED2 | 68.99% | 158 | 6e-77 | SCF ubiquitin ligase, Skp1 component n=10 Tax=Basidiomycota TaxID=5204 RepID=V5EED2_KALBG |
A0A1E3PDZ5_9ASCO | 69.38% | 160 | 7e-77 | E3 ubiquitin ligase SCF complex, Skp subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47850 PE=3 SV=1 |
A0A1E4TAM3_9ASCO | 64.56% | 158 | 5e-73 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_128786 PE=3 SV=1 |
A0A060T3R6_BLAAD | 67.30% | 159 | 5e-68 | ARAD1C39182p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C39182g PE=3 SV=1 |
Q59WE2_CANAL | 60.87% | 161 | 3e-63 | SCF ubiquitin ligase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKP1 PE=3 SV=1 |
SKP1_YEAST | 48.69% | 191 | 3e-57 | Suppressor of kinetochore protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKP1 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0390
Protein family membership
- S-phase kinase-associated protein 1-like (IPR001232)
- S-phase kinase-associated protein 1 (IPR016897)
Domains and repeats
-
Domain
1
20
40
60
80
100
120
140
158
Detailed signature matches
-
-
SM00512 (skp1_3)
-
-
-
PIRSF028729 (SCF_Skp)
-
-
-
SSF54695 (POZ domain)
-
-
-
PF03931 (Skp1_POZ)
-

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_00286_1 MVVLVSSDDVKYTVDNKAASKSVLIKHMMEDLGDEAAEIPLPNATSNVLKKVIEYCEHHKDDPTPPAEDESGKSKRNTEI SQWDASFLQIDQEMLFEIILAANYLDIKPLLDIGCKTVANMIRDKSPEEIRRTFNISNDFSPEEEAQIRSENEWAEDR
GO term prediction
Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process
Molecular Function
None predicted.
Cellular Component
None predicted.