Protein

MCA_00286_1

Length
158 amino acids


Gene name: SKP1A

Description: Suppressor of kinetochore protein 1

Browser: contigA:869616-870205-

RNA-seq: read pairs 3706, FPKM 288.0, percentile rank 91.5% (100% = highest expression)

Protein function

Annotation:SKP1ASuppressor of kinetochore protein 1
KEGG:K03094SKP1 S-phase kinase-associated protein 1
EGGNOG:0PN0QSCONCEssential component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Controls sulfur metabolite repression, probably by mediating the inactivation or degradation of the metR transcription factor (By similarity)
SGD closest match:S000002736SKP1Suppressor of kinetochore protein 1
CGD closest match:CAL0000178736SKP1SCF ubiquitin ligase subunit

Protein alignments

%idAln lengthE-value
MIA_01348_174.68%1585e-87MIA_01348_1
Q6CHA1_YARLI70.99%1622e-83YALI0A10879p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A10879g PE=3 SV=1
A0A0J9X9G2_GEOCN74.21%1593e-83Similar to Saccharomyces cerevisiae YDR328C SKP1 Evolutionarily conserved kinetochore protein OS=Geotrichum candidum GN=BN980_GECA06s04696g PE=3 SV=1
UniRef50_V5EED268.99%1586e-77SCF ubiquitin ligase, Skp1 component n=10 Tax=Basidiomycota TaxID=5204 RepID=V5EED2_KALBG
A0A1E3PDZ5_9ASCO69.38%1607e-77E3 ubiquitin ligase SCF complex, Skp subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47850 PE=3 SV=1
A0A1E4TAM3_9ASCO64.56%1585e-73Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_128786 PE=3 SV=1
A0A060T3R6_BLAAD67.30%1595e-68ARAD1C39182p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C39182g PE=3 SV=1
Q59WE2_CANAL60.87%1613e-63SCF ubiquitin ligase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKP1 PE=3 SV=1
SKP1_YEAST48.69%1913e-57Suppressor of kinetochore protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKP1 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0390

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 158

Detailed signature matches

    1. SM00512 (skp1_3)
    1. PIRSF028729 (SCF_Skp)
    1. SSF54695 (POZ domain)
    1. PF03931 (Skp1_POZ)
    1. SSF81382 (Skp1 dime...)
    2. PF01466 (Skp1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_00286_1
MVVLVSSDDVKYTVDNKAASKSVLIKHMMEDLGDEAAEIPLPNATSNVLKKVIEYCEHHKDDPTPPAEDESGKSKRNTEI
SQWDASFLQIDQEMLFEIILAANYLDIKPLLDIGCKTVANMIRDKSPEEIRRTFNISNDFSPEEEAQIRSENEWAEDR

GO term prediction

Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process

Molecular Function

None predicted.

Cellular Component

None predicted.