Protein
MCA_00262_1
Length
172 amino acids
Gene name: SPC19
Description: DASH complex subunit SPC19
Browser: contigA:804173-804805-
RNA-seq: read pairs 925, FPKM 66.1, percentile rank 71.3% (100% = highest expression)
Protein function
Annotation: | SPC19 | DASH complex subunit SPC19 | |
---|---|---|---|
KEGG: | K11572 | SPC19 | DASH complex subunit SPC19 |
EGGNOG: | 0PPMH | FG09434.1 | Mitotic spindle biogenesis protein Spc19 |
CGD closest match: | CAL0000196840 | SPC19 | DASH complex subunit SPC19 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XHQ8_GEOCN | 36.81% | 163 | 2e-21 | Similar to Saccharomyces cerevisiae YDR201W SPC19 Essential subunit of the Dam1 complex (Aka DASH complex) OS=Geotrichum candidum GN=BN980_GECA17s00637g PE=4 SV=1 |
UniRef50_A0A0J9XHQ8 | 36.81% | 163 | 3e-18 | Similar to Saccharomyces cerevisiae YDR201W SPC19 Essential subunit of the Dam1 complex (Aka DASH complex) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHQ8_GEOCN |
MIA_05139_1 | 35.33% | 150 | 9e-20 | MIA_05139_1 |
A0A060T6E0_BLAAD | 31.58% | 95 | 3e-08 | ARAD1B11286p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B11286g PE=4 SV=1 |
A0A1E3PP39_9ASCO | 28.89% | 90 | 4e-07 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45238 PE=4 SV=1 |
SPC19_CANAL | 26.73% | 101 | 3e-07 | DASH complex subunit SPC19 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPC19 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1028
Protein family membership
- DASH complex subunit Spc19 (IPR013251)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF08287 (DASH_Spc19)
-
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_00262_1 MPETLDGCISGLSNSVSLLRSGSNALGQGIKDFKRLQTILKVSQPFDVVSESEIIQESEELVRTVRPQTDTILQKMESEV ARLKRHEQNLSYQIKLQQERLQQLKALQSKDSADTTSSSSASSYSQKQDYEEEEKIQLERLQAELDRLKYSKSLADLQKK RKKSMSHLKQPF
GO term prediction
Biological Process
GO:0008608 attachment of spindle microtubules to kinetochore
Molecular Function
None predicted.
Cellular Component
GO:0005876 spindle microtubule
GO:0042729 DASH complex