Protein

MIA_05139_1

Length
161 amino acids

Browser: contig07:833405-833937+

Protein function

EGGNOG:0PPMHFG09434.1Mitotic spindle biogenesis protein Spc19

Protein alignments

%idAln lengthE-value
A0A0J9XHQ8_GEOCN33.858%1274.41e-09Similar to Saccharomyces cerevisiae YDR201W SPC19 Essential subunit of the Dam1 complex (Aka DASH complex) OS=Geotrichum candidum GN=BN980_GECA17s00637g PE=4 SV=1
UniRef50_A0A0J9XHQ833.858%1279.02e-06Similar to Saccharomyces cerevisiae YDR201W SPC19 Essential subunit of the Dam1 complex (Aka DASH complex) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHQ8_GEOCN

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3103

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR013251
    DASH complex subunit Spc19
    1. PF08287 (DASH_Spc19)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. mobidb-lite (disord...)

Protein sequence

>MIA_05139_1
MDTLDSCISNLSSAVSSLRSGSQALTPVCSDFTRLKTVLRTDQVFDILSNAEVAQAHADLASAIDPSITALLHKADLEIE
RLERKERELISKGNLQEVRLMQMRSGQTGTAGPEPQPKPTHTSAEEPLASKDQIDEILKLQRQRDRLKYTKWQHQLAGRQ
K

GO term prediction

Biological Process

GO:0008608 attachment of spindle microtubules to kinetochore

Molecular Function

None predicted.

Cellular Component

GO:0005876 spindle microtubule
GO:0042729 DASH complex