Protein

MCA_00214_2

Length
443 amino acids

Gene name: SUB2

Description: ATP-dependent RNA helicase SUB2

Browser: contigA:672950-674350-

RNA-seq: read pairs 9617, FPKM 267.6, percentile rank 91.1% (100% = highest expression)

Protein function

Annotation:SUB2ATP-dependent RNA helicase SUB2
KEGG:K12812UAP56 ATP-dependent RNA helicase UAP56/SUB2 [EC:3.6.4.13]
EGGNOG:0PGTNSUB2ATP-binding RNA helicase involved in transcription elongation and required for the export of mRNA out of the nucleus. SUB2 plays also a role in pre-mRNA splicing and spliceosome assembly. May be involved in rDNA and telomeric silencing, and maintenance of genome integrity
SGD closest match:S000002242SUB2ATP-dependent RNA helicase SUB2
CGD closest match:CAL0000200240SUB2ATP-dependent RNA helicase

Protein alignments

%idAln lengthE-value
MIA_01290_194.59%4070.0MIA_01290_1
A0A0J9XIJ7_GEOCN87.47%4070.0Similar to Saccharomyces cerevisiae YDL084W SUB2 Component of the TREX complex required for nuclear mRNA export OS=Geotrichum candidum GN=BN980_GECA19s00604g PE=4 SV=1
A0A060TG37_BLAAD87.28%4010.0ARAD1D20042p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D20042g PE=4 SV=1
A0A1E3PSC2_9ASCO86.50%4000.0p-loop containing nucleoside triphosphate hydrolase protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_30478 PE=4 SV=1
A0A1D8PKZ3_CANAL80.35%3970.0ATP-dependent RNA helicase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SUB2 PE=4 SV=1
SUB2_YARLI79.60%4020.0ATP-dependent RNA helicase SUB2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SUB2 PE=3 SV=2
UniRef50_O1379277.94%3990.0ATP-dependent RNA helicase uap56 n=174 Tax=Eukaryota TaxID=2759 RepID=SUB2_SCHPO
A0A1E4TDU5_9ASCO77.19%3990.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_24549 PE=4 SV=1
SUB2_YEAST78.34%3970.0ATP-dependent RNA helicase SUB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUB2 PE=1 SV=1
A0A167D571_9ASCO84.52%2524e-158ATP-dependent RNA helicase SUB2 OS=Sugiyamaella lignohabitans GN=SUB2 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0307

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 250 300 350 400 443

Detailed signature matches

  1. Domain IPR014014
    RNA helicase, DEAD-box type, Q motif
    1. PS51195 (Q_MOTIF)
  2. Domain IPR014001
    Helicase superfamily 1/2, ATP-binding domain
    1. PS51192 (HELICASE_A...)
    2. SM00487 (ultradead3)
  3. Domain IPR011545
    DEAD/DEAH box helicase domain
    1. PF00270 (DEAD)
  4. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  5. Domain IPR001650
    Helicase, C-terminal
    1. PS51194 (HELICASE_CTER)
    2. SM00490 (helicmild6)
    3. PF00271 (Helicase_C)
  6. SITE IPR000629
    ATP-dependent RNA helicase DEAD-box, conserved site
    1. PS00039 (DEAD_ATP_H...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...
  2. cd00079 (HELICc)
  3. cd00268 (DEADc)
  4. mobidb-lite (disord...)

Residue annotation

  1. ATP binding site c...
  2. Mg++ binding site ...
  3. motif III cd00268
  4. nucleotide binding...
  5. ATP-binding site c...

Protein sequence

>MCA_00214_2
MSHEGEEELLDYSDSEDIAVPTTTGTTTTTEAGTTADDGLVIKQENGDKKGSYVGIHSTGFKDFLLKPELVRAITDSGFE
HPSEVQQVCIPQSILGTDVLCQAKSGLGKTAVFVLSTLQQIEPVDGEVSVIVLCHTRELAYQIKNEYTRFSKYLPDVRTT
VFYGGTPITKDVALIKDKSTCPHIIVGTPGRLNALVRDRFLRLNNIKTFVIDEADKVLEQPDMRRDVQEIFRSTPHQKQV
MMFSATLSNEIRPVCRKFMQNPLEIFVDDETKLTLHGLQQYYVKLAEREKNRKLNEILDALEFNQVIIFVKSTKRANELN
HLLNDCNFPSIAVHSGIPQEERIARYKSFKTFEKRICVATDVFGRGIDIERINLAINYDLPDNADQYLHRVGRAGRFGTK
GLAVSFVSTEEDQQVLDAIQSRFEVNIAPFPEEGIDSSTYMNS

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding
GO:0005524 ATP binding

Cellular Component

None predicted.